Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1280
Gene name
LocationContig_15:61740..63156
Strand+
Gene length (bp)1416
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01529 DHHC DHHC palmitoyltransferase 1.8E-24 160 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1J3|PFA5_GIBZE Palmitoyltransferase PFA5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA5 PE=3 SV=1 3 409 2.0E-131
sp|Q4WUK1|PFA5_ASPFU Palmitoyltransferase pfa5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa5 PE=3 SV=2 16 403 3.0E-79
sp|Q5B433|PFA5_EMENI Palmitoyltransferase pfa5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa5 PE=3 SV=2 4 420 5.0E-69
sp|Q9C0W9|PFA5_SCHPO Palmitoyltransferase PFA5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfa-5 PE=3 SV=1 144 377 3.0E-25
sp|Q5ADN9|PFA3_CANAL Palmitoyltransferase PFA3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA3 PE=3 SV=1 162 387 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1J3|PFA5_GIBZE Palmitoyltransferase PFA5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA5 PE=3 SV=1 3 409 2.0E-131
sp|Q4WUK1|PFA5_ASPFU Palmitoyltransferase pfa5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa5 PE=3 SV=2 16 403 3.0E-79
sp|Q5B433|PFA5_EMENI Palmitoyltransferase pfa5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa5 PE=3 SV=2 4 420 5.0E-69
sp|Q9C0W9|PFA5_SCHPO Palmitoyltransferase PFA5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfa-5 PE=3 SV=1 144 377 3.0E-25
sp|Q5ADN9|PFA3_CANAL Palmitoyltransferase PFA3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA3 PE=3 SV=1 162 387 2.0E-19
sp|Q6C7D1|PFA5_YARLI Palmitoyltransferase PFA5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA5 PE=3 SV=1 7 377 6.0E-19
sp|Q6CRV3|PFA5_KLULA Palmitoyltransferase PFA5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA5 PE=3 SV=1 122 282 8.0E-17
sp|Q5Y5T1|ZDH20_MOUSE Probable palmitoyltransferase ZDHHC20 OS=Mus musculus GN=Zdhhc20 PE=1 SV=1 20 220 3.0E-16
sp|Q6FW70|PFA3_CANGA Palmitoyltransferase PFA3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA3 PE=3 SV=1 115 377 3.0E-16
sp|P42836|PFA3_YEAST Palmitoyltransferase PFA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA3 PE=1 SV=1 111 374 8.0E-16
sp|Q6C4W5|PFA3_YARLI Palmitoyltransferase PFA3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA3 PE=3 SV=1 156 376 8.0E-15
sp|Q03289|PFA5_YEAST Palmitoyltransferase PFA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA5 PE=1 SV=1 10 373 3.0E-14
sp|Q6FMP5|PFA5_CANGA Palmitoyltransferase PFA5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA5 PE=3 SV=1 127 278 3.0E-14
sp|Q9UIJ5|ZDHC2_HUMAN Palmitoyltransferase ZDHHC2 OS=Homo sapiens GN=ZDHHC2 PE=2 SV=1 3 373 4.0E-14
sp|Q9FLM3|ZDH23_ARATH Probable protein S-acyltransferase 6 OS=Arabidopsis thaliana GN=PAT06 PE=2 SV=1 162 282 1.0E-13
sp|Q93VV0|ZDHC6_ARATH Probable protein S-acyltransferase 16 OS=Arabidopsis thaliana GN=PAT16 PE=2 SV=1 105 287 2.0E-13
sp|Q75AW7|PFA3_ASHGO Palmitoyltransferase PFA3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA3 PE=3 SV=2 41 374 3.0E-13
sp|Q6CPU8|PFA3_KLULA Palmitoyltransferase PFA3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA3 PE=3 SV=1 158 276 3.0E-13
sp|Q6BMV2|PFA3_DEBHA Palmitoyltransferase PFA3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA3 PE=3 SV=2 20 373 4.0E-13
sp|Q4IA62|PFA3_GIBZE Palmitoyltransferase PFA3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA3 PE=3 SV=1 153 284 6.0E-13
sp|Q9JKR5|ZDHC2_RAT Palmitoyltransferase ZDHHC2 OS=Rattus norvegicus GN=Zdhhc2 PE=2 SV=1 20 373 6.0E-13
sp|Q75D19|PFA5_ASHGO Palmitoyltransferase PFA5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA5 PE=3 SV=2 122 392 6.0E-13
sp|Q2TGJ4|ZDH15_RAT Palmitoyltransferase ZDHHC15 OS=Rattus norvegicus GN=Zdhhc15 PE=2 SV=1 158 377 7.0E-13
sp|Q9SB58|ZDH19_ARATH Protein S-acyltransferase 8 OS=Arabidopsis thaliana GN=PAT08 PE=1 SV=2 124 337 8.0E-13
sp|Q8BGJ0|ZDH15_MOUSE Palmitoyltransferase ZDHHC15 OS=Mus musculus GN=Zdhhc15 PE=1 SV=1 159 377 1.0E-12
sp|Q6BP97|PFA5_DEBHA Palmitoyltransferase PFA5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA5 PE=3 SV=2 151 276 1.0E-12
sp|Q59NR8|PFA5_CANAL Palmitoyltransferase PFA5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA5 PE=3 SV=1 127 364 1.0E-12
sp|P59267|ZDHC2_MOUSE Palmitoyltransferase ZDHHC2 OS=Mus musculus GN=Zdhhc2 PE=2 SV=1 20 373 3.0E-12
sp|Q5BD15|PFA4_EMENI Palmitoyltransferase pfa4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa4 PE=3 SV=1 159 377 4.0E-12
sp|Q4WC37|PFA4_ASPFU Palmitoyltransferase pfa4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa4 PE=3 SV=2 126 377 9.0E-12
sp|Q96MV8|ZDH15_HUMAN Palmitoyltransferase ZDHHC15 OS=Homo sapiens GN=ZDHHC15 PE=2 SV=1 159 377 9.0E-12
sp|Q0WQK2|ZDHC9_ARATH Probable protein S-acyltransferase 7 OS=Arabidopsis thaliana GN=PAT07 PE=1 SV=1 140 279 2.0E-11
sp|Q555N7|ZDHC4_DICDI Putative ZDHHC-type palmitoyltransferase 4 OS=Dictyostelium discoideum GN=DDB_G0274251 PE=3 SV=1 150 278 3.0E-11
sp|Q7SCY6|PFA4_NEUCR Palmitoyltransferase pfa4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-4 PE=3 SV=1 160 373 3.0E-11
sp|Q4WZL8|PFA3_ASPFU Palmitoyltransferase pfa3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa3 PE=3 SV=1 159 284 5.0E-11
sp|Q0VC89|ZDH20_BOVIN Probable palmitoyltransferase ZDHHC20 OS=Bos taurus GN=ZDHHC20 PE=2 SV=1 20 373 6.0E-11
sp|C8VCL4|PFA3_EMENI Palmitoyltransferase pfa3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa3 PE=3 SV=2 159 284 7.0E-11
sp|Q7S7C5|PFA3_NEUCR Palmitoyltransferase pfa3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-3 PE=3 SV=3 153 284 1.0E-10
sp|Q8R173|ZDHC3_MOUSE Palmitoyltransferase ZDHHC3 OS=Mus musculus GN=Zdhhc3 PE=1 SV=1 164 281 1.0E-10
sp|O14345|PFA3_SCHPO Palmitoyltransferase pfa3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfa3 PE=3 SV=1 139 376 1.0E-10
sp|Q9NYG2|ZDHC3_HUMAN Palmitoyltransferase ZDHHC3 OS=Homo sapiens GN=ZDHHC3 PE=1 SV=2 164 281 3.0E-10
sp|Q9M1K5|ZDH13_ARATH Probable protein S-acyltransferase 4 OS=Arabidopsis thaliana GN=PAT04 PE=2 SV=1 125 279 7.0E-10
sp|Q4PE27|PFA4_USTMA Palmitoyltransferase PFA4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PFA4 PE=3 SV=2 160 279 9.0E-10
sp|Q6FSS4|ERFB_CANGA Palmitoyltransferase ERF2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERF2 PE=3 SV=1 162 272 1.0E-09
sp|Q9NXF8|ZDHC7_HUMAN Palmitoyltransferase ZDHHC7 OS=Homo sapiens GN=ZDHHC7 PE=1 SV=2 164 279 1.0E-09
sp|Q5FWL7|ZDH15_XENLA Palmitoyltransferase ZDHHC15 OS=Xenopus laevis GN=zdhhc15 PE=2 SV=1 158 219 1.0E-09
sp|Q923G5|ZDHC7_RAT Palmitoyltransferase ZDHHC7 OS=Rattus norvegicus GN=Zdhhc7 PE=1 SV=1 164 279 2.0E-09
sp|Q91WU6|ZDHC7_MOUSE Palmitoyltransferase ZDHHC7 OS=Mus musculus GN=Zdhhc7 PE=1 SV=1 164 279 2.0E-09
sp|Q5FC64|ZDHCS_CAEEL Palmitoyltransferase spe-10 OS=Caenorhabditis elegans GN=spe-10 PE=1 SV=1 155 214 2.0E-09
sp|Q5PNZ1|ZDH21_ARATH Probable protein S-acyltransferase 3 OS=Arabidopsis thaliana GN=PAT03 PE=2 SV=1 141 279 3.0E-09
sp|Q8I0G4|ZDHC4_CAEEL Zinc finger DHHC domain-containing protein 4 OS=Caenorhabditis elegans GN=dhhc-4 PE=3 SV=1 10 219 3.0E-09
sp|Q2THW9|ZDHC5_CANLF Palmitoyltransferase ZDHHC5 OS=Canis lupus familiaris GN=ZDHHC5 PE=2 SV=1 160 269 4.0E-09
sp|Q5W0Z9|ZDH20_HUMAN Probable palmitoyltransferase ZDHHC20 OS=Homo sapiens GN=ZDHHC20 PE=1 SV=1 20 204 4.0E-09
sp|Q2THW8|ZDHC8_CANLF Probable palmitoyltransferase ZDHHC8 OS=Canis lupus familiaris GN=ZDHHC8 PE=2 SV=1 160 271 4.0E-09
sp|Q2THX0|ZDHC8_PANTR Probable palmitoyltransferase ZDHHC8 OS=Pan troglodytes GN=ZDHHC8 PE=2 SV=1 160 271 4.0E-09
sp|Q9ULC8|ZDHC8_HUMAN Probable palmitoyltransferase ZDHHC8 OS=Homo sapiens GN=ZDHHC8 PE=1 SV=3 160 271 4.0E-09
sp|Q5Y5T5|ZDHC8_MOUSE Probable palmitoyltransferase ZDHHC8 OS=Mus musculus GN=Zdhhc8 PE=1 SV=1 160 269 5.0E-09
sp|E1BLT8|ZDHC5_BOVIN Palmitoyltransferase ZDHHC5 OS=Bos taurus GN=ZDHHC5 PE=3 SV=1 160 269 6.0E-09
sp|Q2THX1|ZDHC5_PANTR Palmitoyltransferase ZDHHC5 OS=Pan troglodytes GN=ZDHHC5 PE=2 SV=1 160 269 6.0E-09
sp|Q8VDZ4|ZDHC5_MOUSE Palmitoyltransferase ZDHHC5 OS=Mus musculus GN=Zdhhc5 PE=1 SV=1 160 269 6.0E-09
sp|Q9C0B5|ZDHC5_HUMAN Palmitoyltransferase ZDHHC5 OS=Homo sapiens GN=ZDHHC5 PE=1 SV=2 160 269 6.0E-09
sp|Q8BQQ1|ZDH14_MOUSE Probable palmitoyltransferase ZDHHC14 OS=Mus musculus GN=Zdhhc14 PE=1 SV=1 149 236 7.0E-09
sp|Q4R7E2|ZDH16_MACFA Probable palmitoyltransferase ZDHHC16 OS=Macaca fascicularis GN=ZDHHC16 PE=2 SV=1 164 385 7.0E-09
sp|Q2THW7|ZDHC5_RAT Palmitoyltransferase ZDHHC5 OS=Rattus norvegicus GN=Zdhhc5 PE=1 SV=1 160 269 7.0E-09
sp|Q5R838|ZDHC5_PONAB Palmitoyltransferase ZDHHC5 OS=Pongo abelii GN=ZDHHC5 PE=2 SV=1 160 269 8.0E-09
sp|B3DN87|ZDH12_ARATH Probable protein S-acyltransferase 1 OS=Arabidopsis thaliana GN=PAT01 PE=2 SV=1 149 279 9.0E-09
sp|Q86A83|ZDHC2_DICDI Putative ZDHHC-type palmitoyltransferase 2 OS=Dictyostelium discoideum GN=DDB_G0274739 PE=2 SV=2 156 214 9.0E-09
sp|Q969W1|ZDH16_HUMAN Probable palmitoyltransferase ZDHHC16 OS=Homo sapiens GN=ZDHHC16 PE=2 SV=1 164 385 1.0E-08
sp|Q58CU4|ZDH16_BOVIN Probable palmitoyltransferase ZDHHC16 OS=Bos taurus GN=ZDHHC16 PE=2 SV=1 164 221 1.0E-08
sp|Q6BLY8|PFA4_DEBHA Palmitoyltransferase PFA4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA4 PE=3 SV=2 162 278 1.0E-08
sp|Q8IZN3|ZDH14_HUMAN Probable palmitoyltransferase ZDHHC14 OS=Homo sapiens GN=ZDHHC14 PE=1 SV=1 149 219 1.0E-08
sp|Q4IMZ7|PFA4_GIBZE Palmitoyltransferase PFA4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA4 PE=3 SV=1 154 377 1.0E-08
sp|Q9ESG8|ZDH16_MOUSE Probable palmitoyltransferase ZDHHC16 OS=Mus musculus GN=Zdhhc16 PE=1 SV=2 164 221 1.0E-08
sp|P59268|ZDHC9_MOUSE Palmitoyltransferase ZDHHC9 OS=Mus musculus GN=Zdhhc9 PE=2 SV=1 133 223 2.0E-08
sp|Q9M306|ZDH10_ARATH Probable protein S-acyltransferase 5 OS=Arabidopsis thaliana GN=PAT05 PE=1 SV=2 149 279 2.0E-08
sp|Q58DA8|ZDHC9_BOVIN Palmitoyltransferase ZDHHC9 OS=Bos taurus GN=ZDHHC9 PE=2 SV=1 162 223 2.0E-08
sp|Q9Y397|ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 OS=Homo sapiens GN=ZDHHC9 PE=1 SV=2 133 223 2.0E-08
sp|Q9D270|ZDH21_MOUSE Probable palmitoyltransferase ZDHHC21 OS=Mus musculus GN=Zdhhc21 PE=1 SV=2 164 302 2.0E-08
sp|Q5R5J8|ZDHC9_PONAB Palmitoyltransferase ZDHHC9 OS=Pongo abelii GN=ZDHHC9 PE=2 SV=1 162 223 2.0E-08
sp|A2VDT6|ZDH21_BOVIN Probable palmitoyltransferase ZDHHC21 OS=Bos taurus GN=ZDHHC21 PE=2 SV=1 164 302 2.0E-08
sp|Q5RB84|ZDH21_PONAB Probable palmitoyltransferase ZDHHC21 OS=Pongo abelii GN=ZDHHC21 PE=2 SV=1 164 302 2.0E-08
sp|Q8IVQ6|ZDH21_HUMAN Palmitoyltransferase ZDHHC21 OS=Homo sapiens GN=ZDHHC21 PE=2 SV=1 164 302 2.0E-08
sp|Q6CQB5|ERFB_KLULA Palmitoyltransferase ERF2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERF2 PE=3 SV=1 162 295 3.0E-08
sp|O80685|ZDHC4_ARATH Probable protein S-acyltransferase 2 OS=Arabidopsis thaliana GN=PAT02 PE=2 SV=3 149 279 3.0E-08
sp|Q750R7|ERFB_ASHGO Palmitoyltransferase ERF2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERF2 PE=3 SV=1 160 322 4.0E-08
sp|O60069|SWF1_SCHPO Palmitoyltransferase swf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swf1 PE=3 SV=1 161 375 7.0E-08
sp|Q550R7|ZDHC1_DICDI Putative ZDHHC-type palmitoyltransferase 1 OS=Dictyostelium discoideum GN=DDB_G0276997 PE=3 SV=3 162 239 7.0E-08
sp|Q7SFL7|ERFB_NEUCR Palmitoyltransferase erf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-2 PE=3 SV=1 162 225 8.0E-08
sp|Q5Y5T2|ZDH18_MOUSE Palmitoyltransferase ZDHHC18 OS=Mus musculus GN=Zdhhc18 PE=1 SV=4 149 210 1.0E-07
sp|Q06551|ERFB_YEAST Palmitoyltransferase ERF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERF2 PE=1 SV=1 158 238 1.0E-07
sp|Q6CUB5|PFA4_KLULA Palmitoyltransferase PFA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA4 PE=3 SV=1 162 229 1.0E-07
sp|Q9NUE0|ZDH18_HUMAN Palmitoyltransferase ZDHHC18 OS=Homo sapiens GN=ZDHHC18 PE=2 SV=2 162 210 1.0E-07
sp|Q2TGJ1|ZDH18_RAT Palmitoyltransferase ZDHHC18 OS=Rattus norvegicus GN=Zdhhc18 PE=2 SV=1 162 210 2.0E-07
sp|Q6C7Q0|PFA4_YARLI Palmitoyltransferase PFA4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA4 PE=3 SV=1 158 222 2.0E-07
sp|P0CS68|PFA4_CRYNJ Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFA4 PE=3 SV=2 161 289 3.0E-07
sp|P0CS69|PFA4_CRYNB Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFA4 PE=3 SV=1 161 289 3.0E-07
sp|Q75CB4|PFA4_ASHGO Palmitoyltransferase PFA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA4 PE=3 SV=2 162 294 6.0E-07
sp|Q12006|PFA4_YEAST Palmitoyltransferase PFA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA4 PE=1 SV=1 157 268 6.0E-07
sp|Q8VYS8|ZDH24_ARATH Probable protein S-acyltransferase 9 OS=Arabidopsis thaliana GN=PAT09 PE=2 SV=1 140 279 9.0E-07
sp|J9VJ99|PFA4_CRYNH Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=PFA4 PE=1 SV=2 161 289 1.0E-06
sp|Q8VYP5|ZDH14_ARATH Probable protein S-acyltransferase 14 OS=Arabidopsis thaliana GN=PAT14 PE=2 SV=1 9 205 1.0E-06
sp|Q6FVE6|PFA4_CANGA Palmitoyltransferase PFA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA4 PE=3 SV=1 163 215 1.0E-06
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 164 251 2.0E-06
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 164 251 2.0E-06
sp|Q94C49|ZDH18_ARATH Probable protein S-acyltransferase 13 OS=Arabidopsis thaliana GN=PAT13 PE=2 SV=1 126 204 3.0E-06
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 164 251 3.0E-06
sp|Q5AGV7|PFA4_CANAL Palmitoyltransferase PFA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA4 PE=3 SV=1 136 210 4.0E-06
sp|Q500Z2|ZDH20_ARATH Probable protein S-acyltransferase 15 OS=Arabidopsis thaliana GN=PAT15 PE=2 SV=1 164 372 6.0E-06
sp|Q6C890|ERFB_YARLI Palmitoyltransferase ERF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERF2 PE=3 SV=2 135 212 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016409 palmitoyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 49 71 22
3 206 228 22
4 241 263 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1280
MRPGDSNRTATRWSIRLMPLFIAAVLGIATYAVVYRLCVRFLYRKLGKSGLTATFLVLYWVFFLLAGASYFRTFA
AAQFNSGLVPLLHKRHVVVRPSSDEHSSAMCAGKGSVGVFAKRPSKGRGRDPERSPWVPPDQDPDSPGLEAFYSK
DVFLCEPDGRPKWCSDCRQWKPDRAHHSSELDRCVRKMDHLCPWVGGMVSETSFNFFFQFTFYTFCFCVICISSC
AYALHQEKLRGPKVDGWFIAIVAIASIFTFFTLAMTLTSAQLILTNYTSIDILRKSHVIFLAVRIPRNSPSTEAF
TTVSYPLERPPPSMSDTSHARSSMDRDPSRDRRATRKFAILRLEPNDNPWDLGYWGNWKSVMGNNIFEWLLPIRH
SPCCNHESMESDYRLGPLLAASKKRYGVPELDGDVDGVVEMHDTAMLAP*
Coding >Ophun1|1280
ATGCGGCCAGGCGACAGCAATCGCACCGCCACGCGCTGGTCCATCCGGCTGATGCCCCTGTTCATCGCCGCCGTC
CTCGGAATCGCCACCTACGCCGTCGTCTACCGTCTGTGTGTCCGCTTCTTGTACCGGAAGCTGGGCAAGTCGGGC
CTCACCGCTACCTTTCTCGTTCTCTACTGGGTCTTCTTCCTGCTGGCCGGCGCCAGTTACTTTCGGACCTTTGCC
GCTGCCCAGTTCAACTCGGGTCTCGTCCCGCTGTTGCACAAGCGTCATGTCGTTGTCCGCCCGTCGTCGGACGAG
CACTCGTCTGCCATGTGTGCCGGTAAAGGATCCGTTGGCGTGTTTGCCAAACGGCCCAGTAAGGGTCGCGGCCGG
GATCCGGAGAGGAGCCCGTGGGTGCCGCCGGATCAGGACCCGGACAGCCCCGGTCTCGAGGCCTTTTACAGCAAG
GACGTCTTTCTCTGCGAGCCTGACGGGCGACCAAAGTGGTGCTCCGACTGTCGACAGTGGAAGCCTGACCGCGCT
CACCACTCGAGCGAGCTGGACCGCTGCGTCCGCAAGATGGACCATTTGTGTCCCTGGGTTGGCGGCATGGTGTCC
GAGACATCATTTAACTTTTTCTTTCAGTTCACCTTTTACACGTTTTGTTTCTGCGTCATCTGCATCTCCTCTTGC
GCTTACGCCCTACATCAGGAGAAGCTTCGCGGGCCCAAGGTCGATGGCTGGTTCATCGCCATAGTCGCCATCGCC
TCCATCTTCACCTTCTTCACATTGGCCATGACGCTGACGTCTGCTCAACTAATCCTCACAAACTACACCAGCATT
GACATCCTGAGAAAGTCGCACGTCATCTTTCTCGCCGTCCGCATCCCGCGAAACAGCCCGTCCACCGAGGCTTTC
ACCACAGTCAGCTATCCGCTGGAGCGTCCTCCGCCCAGCATGTCGGACACGTCGCACGCCCGCTCCAGCATGGAC
CGCGATCCGTCCAGGGACCGGCGCGCGACGAGGAAATTCGCCATCCTGCGGCTCGAGCCCAACGACAACCCCTGG
GATCTGGGCTACTGGGGGAACTGGAAGTCCGTCATGGGCAACAACATCTTTGAGTGGCTGCTGCCCATCAGACAC
TCCCCTTGCTGCAACCACGAGAGCATGGAGAGCGACTACCGGCTGGGGCCGCTGCTGGCTGCTTCCAAGAAGAGG
TATGGCGTGCCCGAGCTCGACGGAGATGTCGATGGGGTGGTTGAGATGCACGATACGGCCATGCTTGCGCCGTGA
Transcript >Ophun1|1280
ATGCGGCCAGGCGACAGCAATCGCACCGCCACGCGCTGGTCCATCCGGCTGATGCCCCTGTTCATCGCCGCCGTC
CTCGGAATCGCCACCTACGCCGTCGTCTACCGTCTGTGTGTCCGCTTCTTGTACCGGAAGCTGGGCAAGTCGGGC
CTCACCGCTACCTTTCTCGTTCTCTACTGGGTCTTCTTCCTGCTGGCCGGCGCCAGTTACTTTCGGACCTTTGCC
GCTGCCCAGTTCAACTCGGGTCTCGTCCCGCTGTTGCACAAGCGTCATGTCGTTGTCCGCCCGTCGTCGGACGAG
CACTCGTCTGCCATGTGTGCCGGTAAAGGATCCGTTGGCGTGTTTGCCAAACGGCCCAGTAAGGGTCGCGGCCGG
GATCCGGAGAGGAGCCCGTGGGTGCCGCCGGATCAGGACCCGGACAGCCCCGGTCTCGAGGCCTTTTACAGCAAG
GACGTCTTTCTCTGCGAGCCTGACGGGCGACCAAAGTGGTGCTCCGACTGTCGACAGTGGAAGCCTGACCGCGCT
CACCACTCGAGCGAGCTGGACCGCTGCGTCCGCAAGATGGACCATTTGTGTCCCTGGGTTGGCGGCATGGTGTCC
GAGACATCATTTAACTTTTTCTTTCAGTTCACCTTTTACACGTTTTGTTTCTGCGTCATCTGCATCTCCTCTTGC
GCTTACGCCCTACATCAGGAGAAGCTTCGCGGGCCCAAGGTCGATGGCTGGTTCATCGCCATAGTCGCCATCGCC
TCCATCTTCACCTTCTTCACATTGGCCATGACGCTGACGTCTGCTCAACTAATCCTCACAAACTACACCAGCATT
GACATCCTGAGAAAGTCGCACGTCATCTTTCTCGCCGTCCGCATCCCGCGAAACAGCCCGTCCACCGAGGCTTTC
ACCACAGTCAGCTATCCGCTGGAGCGTCCTCCGCCCAGCATGTCGGACACGTCGCACGCCCGCTCCAGCATGGAC
CGCGATCCGTCCAGGGACCGGCGCGCGACGAGGAAATTCGCCATCCTGCGGCTCGAGCCCAACGACAACCCCTGG
GATCTGGGCTACTGGGGGAACTGGAAGTCCGTCATGGGCAACAACATCTTTGAGTGGCTGCTGCCCATCAGACAC
TCCCCTTGCTGCAACCACGAGAGCATGGAGAGCGACTACCGGCTGGGGCCGCTGCTGGCTGCTTCCAAGAAGAGG
TATGGCGTGCCCGAGCTCGACGGAGATGTCGATGGGGTGGTTGAGATGCACGATACGGCCATGCTTGCGCCGTGA
Gene >Ophun1|1280
ATGCGGCCAGGCGACAGCAATCGCACCGCCACGCGCTGGTCCATCCGGCTGATGCCCCTGTTCATCGCCGCCGTC
CTCGGAATCGCCACCTACGCCGTCGTCTACCGTCTGTGTGGTGCGTCTCTTCCCTCCCGCTCTCGGCCCGGCCTC
CCCGGAGGTTCTATTATGACCCTCCCTTATGGCTGCTGACGGCTTTCTGCTGTCTAGTCCGCTTCTTGTACCGGA
AGCTGGGCAAGTCGGGCCTCACCGCTACCTTTCTCGTTCTCTACTGGGTCTTCTTCCTGCTGGCCGGCGCCAGTT
ACTTTCGGACCTTTGCCGCTGCCCAGTTCAACTCGGGTCTCGTCCCGCTGTTGCACAAGCGTCATGTCGTTGTCC
GCCCGTCGTCGGACGAGCACTCGTCTGCCATGTGTGCCGGTAAAGGATCCGTTGGCGTGTTTGCCAAACGGCCCA
GTAAGGGTCGCGGCCGGGATCCGGAGAGGAGCCCGTGGGTGCCGCCGGATCAGGACCCGGACAGCCCCGGTCTCG
AGGCCTTTTACAGCAAGGACGTCTTTCTCTGCGAGCCTGACGGGCGACCAAAGTGGTGCTCCGACTGTCGACAGT
GGAAGCCTGACCGCGCTCACCACTCGAGCGAGCTGGACCGCTGCGTCCGCAAGATGGACCATTTGTGTCCCTGGG
TTGGCGGCATGGTGTCCGAGACATGTAGGGCTCCCGGATGGGCTCTTCCTCATCGTACTGACTCATCTCACAGCA
TTTAACTTTTTCTTTCAGTTCACCTTTTACACGTTTTGTTTCTGCGTCATCTGCATCTCCTCTTGCGCTTACGCC
CTACATCAGGAGAAGCTTCGCGGGCCCAAGGTCGATGGCTGGTTCATCGCCATAGTCGCCATCGCCTCCATCTTC
ACCTTCTTCACATTGGCCATGACGCTGACGTCTGCTCAACTAATCCTCACAAACTACACCAGCATTGACATCCTG
AGAAAGTCGCACGTCATCTTTCTCGCCGTCCGCATCCCGCGAAACAGCCCGTCCACCGAGGCTTTCACCACAGTC
AGCTATCCGCTGGAGCGTCCTCCGCCCAGCATGTCGGACACGTCGCACGCCCGCTCCAGCATGGACCGCGATCCG
TCCAGGGACCGGCGCGCGACGAGGAAATTCGCCATCCTGCGGCTCGAGCCCAACGACAACCCCTGGGATCTGGGC
TACTGGGGGAACTGGAAGTCCGTCATGGGCAACAACATCTTTGAGTGGCTGCTGCCCATCAGACACTCCCCTTGC
TGCAACCACGAGAGCATGGAGAGCGACTACCGGCTGGGGCCGCTGCTGGCTGCTTCCAAGAAGAGGTATGGCGTG
CCCGAGCTCGACGGAGATGTCGATGGGGTGGTTGAGATGCACGATACGGCCATGCTTGCGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail