Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1277
Gene name
LocationContig_15:55177..56614
Strand+
Gene length (bp)1437
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13091 PLDc_2 PLD-like domain 5.5E-11 305 452

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2415
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4868
Ophiocordyceps australis map64 (Brazil) OphauB2|4785
Ophiocordyceps camponoti-floridani Ophcf2|03412
Ophiocordyceps camponoti-rufipedis Ophun1|1277 (this protein)
Ophiocordyceps kimflemingae Ophio5|1147
Ophiocordyceps subramaniannii Hirsu2|3428

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1277
MSSAFPASFVTPWRELLASHQAQQANDLPSYYVADWDALVTTSVSKSLHVGIGYSVYTRAILPAILRAKHAVYFV
TCYWTSSPTLDAFRDTLTQLAASRRCLDQGTPPLQITIGFSSMGLFQKLFHTSSRNGHVYPPSQWPKLGLPDEAT
LRAGAIEMTVKSLFFTPFSVMHPKYIIIDGVQAFMPSCNVSWERWFEGCIELEGDVVQCLLAFHRRVWRPPVEPD
AHQQQVEVSSERSERLETTSRDAAEEDDMSPTRSLRLGLSFPVPTVLLPSPHHRNPRFSLFPLLSQSEPPMTPLN
AALFTLFANAKREITILSPNFTSWPVLEALLEALARGIDVRIRTSKAMMLIEQLVTAGTTTSRCLRKFIKEYQGL
HSASRLADLEAQPVSPGRLDILYYKPLASRQQSVDEPVFSHFKMTLVDGEYLVLGSGNMDRASWWTSQELGILFY
VPNFEGYALWDDVLSPRTEVMYRSAGCS*
Coding >Ophun1|1277
ATGTCCTCCGCATTCCCGGCCTCCTTTGTGACGCCATGGAGGGAACTTCTCGCATCTCACCAGGCACAGCAGGCA
AATGATTTGCCCAGCTACTACGTTGCCGACTGGGACGCCCTCGTCACCACCAGCGTATCGAAGTCGCTTCATGTC
GGTATTGGATACTCGGTCTACACTCGTGCCATCCTGCCGGCAATTCTGAGGGCAAAGCATGCAGTATACTTTGTG
ACATGCTACTGGACGTCATCTCCAACCCTCGACGCCTTTCGTGATACCCTCACCCAGCTGGCGGCGTCTCGGAGA
TGTCTAGACCAAGGGACGCCTCCGCTGCAGATTACCATCGGCTTTTCTTCCATGGGACTCTTTCAGAAGTTGTTC
CATACGTCTTCCCGTAACGGCCACGTTTACCCGCCCTCGCAATGGCCAAAGCTTGGCCTTCCCGACGAGGCCACA
TTGCGTGCTGGAGCCATTGAGATGACAGTCAAGAGCCTCTTCTTTACACCATTCAGCGTCATGCACCCCAAGTAC
ATCATCATCGATGGCGTCCAAGCATTCATGCCTAGCTGCAACGTCAGCTGGGAACGCTGGTTCGAGGGATGCATT
GAGCTCGAGGGAGACGTCGTCCAATGTCTGCTGGCCTTTCATCGACGCGTTTGGCGTCCGCCTGTCGAGCCGGAC
GCTCATCAGCAACAAGTCGAGGTGTCGTCGGAGCGAAGTGAGCGTCTCGAGACGACGAGCCGGGACGCAGCGGAG
GAAGACGACATGTCGCCTACACGATCCTTACGACTCGGCCTGTCGTTTCCTGTGCCCACCGTCCTTCTTCCTTCG
CCGCACCACCGAAACCCTCGATTCAGCCTTTTCCCTTTGCTGTCTCAGTCGGAACCTCCAATGACGCCCCTGAAC
GCCGCGCTCTTCACCCTGTTCGCCAACGCAAAGCGTGAAATCACCATACTATCTCCCAACTTTACCTCATGGCCT
GTCCTGGAAGCCCTCCTTGAGGCACTTGCTCGCGGAATCGACGTACGAATCCGCACCAGCAAAGCCATGATGTTG
ATCGAACAGCTCGTCACGGCTGGCACGACGACGTCGAGGTGTCTCCGAAAATTCATCAAGGAATATCAAGGCCTG
CACTCAGCGTCCCGGCTGGCGGATCTGGAAGCCCAACCAGTGTCTCCCGGGCGACTGGATATCTTGTATTACAAG
CCACTCGCCAGCCGGCAGCAGAGCGTCGACGAGCCGGTCTTCAGTCACTTCAAGATGACATTGGTGGACGGCGAG
TATCTGGTTCTGGGATCGGGAAACATGGACAGAGCGAGCTGGTGGACCAGCCAGGAGCTCGGGATTCTGTTCTAC
GTCCCGAACTTTGAGGGATATGCGCTATGGGATGATGTTTTGAGTCCGCGGACAGAGGTCATGTATCGATCGGCG
GGATGTTCATGA
Transcript >Ophun1|1277
ATGTCCTCCGCATTCCCGGCCTCCTTTGTGACGCCATGGAGGGAACTTCTCGCATCTCACCAGGCACAGCAGGCA
AATGATTTGCCCAGCTACTACGTTGCCGACTGGGACGCCCTCGTCACCACCAGCGTATCGAAGTCGCTTCATGTC
GGTATTGGATACTCGGTCTACACTCGTGCCATCCTGCCGGCAATTCTGAGGGCAAAGCATGCAGTATACTTTGTG
ACATGCTACTGGACGTCATCTCCAACCCTCGACGCCTTTCGTGATACCCTCACCCAGCTGGCGGCGTCTCGGAGA
TGTCTAGACCAAGGGACGCCTCCGCTGCAGATTACCATCGGCTTTTCTTCCATGGGACTCTTTCAGAAGTTGTTC
CATACGTCTTCCCGTAACGGCCACGTTTACCCGCCCTCGCAATGGCCAAAGCTTGGCCTTCCCGACGAGGCCACA
TTGCGTGCTGGAGCCATTGAGATGACAGTCAAGAGCCTCTTCTTTACACCATTCAGCGTCATGCACCCCAAGTAC
ATCATCATCGATGGCGTCCAAGCATTCATGCCTAGCTGCAACGTCAGCTGGGAACGCTGGTTCGAGGGATGCATT
GAGCTCGAGGGAGACGTCGTCCAATGTCTGCTGGCCTTTCATCGACGCGTTTGGCGTCCGCCTGTCGAGCCGGAC
GCTCATCAGCAACAAGTCGAGGTGTCGTCGGAGCGAAGTGAGCGTCTCGAGACGACGAGCCGGGACGCAGCGGAG
GAAGACGACATGTCGCCTACACGATCCTTACGACTCGGCCTGTCGTTTCCTGTGCCCACCGTCCTTCTTCCTTCG
CCGCACCACCGAAACCCTCGATTCAGCCTTTTCCCTTTGCTGTCTCAGTCGGAACCTCCAATGACGCCCCTGAAC
GCCGCGCTCTTCACCCTGTTCGCCAACGCAAAGCGTGAAATCACCATACTATCTCCCAACTTTACCTCATGGCCT
GTCCTGGAAGCCCTCCTTGAGGCACTTGCTCGCGGAATCGACGTACGAATCCGCACCAGCAAAGCCATGATGTTG
ATCGAACAGCTCGTCACGGCTGGCACGACGACGTCGAGGTGTCTCCGAAAATTCATCAAGGAATATCAAGGCCTG
CACTCAGCGTCCCGGCTGGCGGATCTGGAAGCCCAACCAGTGTCTCCCGGGCGACTGGATATCTTGTATTACAAG
CCACTCGCCAGCCGGCAGCAGAGCGTCGACGAGCCGGTCTTCAGTCACTTCAAGATGACATTGGTGGACGGCGAG
TATCTGGTTCTGGGATCGGGAAACATGGACAGAGCGAGCTGGTGGACCAGCCAGGAGCTCGGGATTCTGTTCTAC
GTCCCGAACTTTGAGGGATATGCGCTATGGGATGATGTTTTGAGTCCGCGGACAGAGGTCATGTATCGATCGGCG
GGATGTTCATGA
Gene >Ophun1|1277
ATGTCCTCCGCATTCCCGGCCTCCTTTGTGACGCCATGGAGGGAACTTCTCGCATCTCACCAGGCACAGCAGGCA
AATGATTTGCCCAGCTACTACGTTGCCGACTGGGACGCCCTCGTCACCACCAGCGTATCGAAGTCGCTTCATGTC
GGTATTGGATACTCGGTCTACACTCGTGCCATCCTGCCGGCAATTCTGAGGGCAAAGCATGCAGTATACTTTGTG
ACATGCTACTGGACGTCATCTCCAACCCTCGACGCCTTTCGTGATACCCTCACCCAGCTGGCGGCGTCTCGGAGA
TGTCTAGACCAAGGGACGCCTCCGCTGCAGATTACCATCGGCTTTTCTTCCATGGGACTCTTTCAGAAGTTGTTC
CATACGTCTTCCCGTAACGGCCACGTTTACCCGCCCTCGCAATGGCCAAAGCTTGGCCTTCCCGACGAGGCCACA
TTGCGTGCTGGAGCCATTGAGATGACAGTCAAGAGCCTCTTCTTTACACCATTCAGCGTCATGCACCCCAAGTAC
ATCATCATCGATGGCGTCCAAGCATTCATGCCTAGCTGCAACGTCAGCTGGGAACGCTGGTTCGAGGGATGCATT
GAGCTCGAGGGAGACGTCGTCCAATGTCTGCTGGCCTTTCATCGACGCGTTTGGCGTCCGCCTGTCGAGCCGGAC
GCTCATCAGCAACAAGTCGAGGTGTCGTCGGAGCGAAGTGAGCGTCTCGAGACGACGAGCCGGGACGCAGCGGAG
GAAGACGACATGTCGCCTACACGATCCTTACGACTCGGCCTGTCGTTTCCTGTGCCCACCGTCCTTCTTCCTTCG
CCGCACCACCGAAACCCTCGATTCAGCCTTTTCCCTTTGCTGTCTCAGTCGGAACCTCCAATGACGCCCCTGAAC
GCCGCGCTCTTCACCCTGTTCGCCAACGCAAAGCGTGAAATCACCATACTATCTCCCAACTTTACCTCATGGCCT
GTCCTGGAAGCCCTCCTTGAGGCACTTGCTCGCGGAATCGACGTACGAATCCGCACCAGCAAAGCCATGATGTTG
ATCGAACAGCTCGTCACGGCTGGCACGACGACGTCGAGGTGTCTCCGAAAATTCATCAAGGAATATCAAGGCCTG
CACTCAGCGTCCCGGCTGGCGGATCTGGAAGCCCAACCAGTGTCTCCCGGGCGACTGGATATCTTGTATTACAAG
CCACTCGCCAGCCGGCAGCAGAGCGTCGACGAGCCGGTCTTCAGTCACTTCAAGATGACATTGGTGGACGGCGAG
TATCTGGTTCTGGGATCGGGAAACATGGACAGAGCGAGCTGGTGGACCAGCCAGGAGCTCGGGATTCTGTTCTAC
GTCCCGAACTTTGAGGGATATGCGCTATGGGATGATGTTTTGAGTCCGCGGACAGAGGTCATGTATCGATCGGCG
GGATGTTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail