Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1275
Gene name
LocationContig_15:51311..51858
Strand-
Gene length (bp)547
Transcript length (bp)342
Coding sequence length (bp)342
Protein length (aa) 114

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2418
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1566
Ophiocordyceps australis map64 (Brazil) OphauB2|4788
Ophiocordyceps camponoti-floridani Ophcf2|03410
Ophiocordyceps camponoti-rufipedis Ophun1|1275 (this protein)
Ophiocordyceps kimflemingae Ophio5|3881
Ophiocordyceps subramaniannii Hirsu2|3433

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1275
MAPSVRTSARYSTYSMAAPSFAPTVKTSDSAHAEIRDIASGLDRMENKALSSQRVALTDEKTDRLGKLALGAKLE
RALGRRMSGQDAVMRPRPKSVAISLSLNEKKAAADKAA*
Coding >Ophun1|1275
ATGGCCCCATCAGTCCGAACCTCGGCCCGCTACAGCACCTACAGCATGGCAGCCCCGTCCTTCGCGCCCACGGTG
AAGACTTCCGATTCCGCCCACGCCGAGATACGCGACATCGCCTCGGGCCTCGACCGCATGGAGAACAAGGCCCTC
TCCTCCCAGAGAGTCGCCCTCACCGACGAAAAGACGGACAGGCTCGGCAAACTCGCCCTCGGCGCCAAGTTGGAA
CGCGCCCTCGGCCGTCGCATGAGTGGTCAGGACGCCGTCATGCGCCCGCGCCCCAAGAGCGTCGCCATCAGCCTG
TCGCTCAACGAGAAGAAAGCCGCGGCTGACAAGGCTGCGTAA
Transcript >Ophun1|1275
ATGGCCCCATCAGTCCGAACCTCGGCCCGCTACAGCACCTACAGCATGGCAGCCCCGTCCTTCGCGCCCACGGTG
AAGACTTCCGATTCCGCCCACGCCGAGATACGCGACATCGCCTCGGGCCTCGACCGCATGGAGAACAAGGCCCTC
TCCTCCCAGAGAGTCGCCCTCACCGACGAAAAGACGGACAGGCTCGGCAAACTCGCCCTCGGCGCCAAGTTGGAA
CGCGCCCTCGGCCGTCGCATGAGTGGTCAGGACGCCGTCATGCGCCCGCGCCCCAAGAGCGTCGCCATCAGCCTG
TCGCTCAACGAGAAGAAAGCCGCGGCTGACAAGGCTGCGTAA
Gene >Ophun1|1275
ATGGCCCCATCAGTACGTTCGTGTCATTTTTTCTCTCCCGTCTTGCCTCCTTTCCTCCCCTCTCTCTCCCCTCCC
CCTCTTCGCGTCGCTGTCCTCTCCGGCCAACCATCACACAAACAAGCAGTCAAGATTCAATTCGTCAAAGACGTC
CCAAGCGGTGCGTGCGTCCCGTGCGCGAATAAACCAGACTAAAAGCTGATACCATCCGTCTCTTCAGGTCCGAAC
CTCGGCCCGCTACAGCACCTACAGCATGGCAGCCCCGTCCTTCGCGCCCACGGTGAAGACTTCCGATTCCGCCCA
CGCCGAGATACGCGACATCGCCTCGGGCCTCGACCGCATGGAGAACAAGGCCCTCTCCTCCCAGAGAGTCGCCCT
CACCGACGAAAAGACGGACAGGCTCGGCAAACTCGCCCTCGGCGCCAAGTTGGAACGCGCCCTCGGCCGTCGCAT
GAGTGGTCAGGACGCCGTCATGCGCCCGCGCCCCAAGAGCGTCGCCATCAGCCTGTCGCTCAACGAGAAGAAAGC
CGCGGCTGACAAGGCTGCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail