Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1269
Gene name
LocationContig_15:30855..34768
Strand-
Gene length (bp)3913
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02386 TrkH Cation transport protein 5.4E-75 175 495

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 176 495 8.0E-62
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 176 497 2.0E-58
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 204 497 1.0E-50
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 176 398 6.0E-48
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 176 398 1.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 176 495 8.0E-62
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 176 497 2.0E-58
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 204 497 1.0E-50
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 176 398 6.0E-48
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 176 398 1.0E-47
sp|Q54DA4|Y2412_DICDI Putative potassium transport protein DDB_G0292412 OS=Dictyostelium discoideum GN=DDB_G0292412 PE=2 SV=1 177 472 4.0E-23
sp|A2YGP9|HKT1_ORYSI Cation transporter HKT1 OS=Oryza sativa subsp. indica GN=HKT1 PE=1 SV=2 177 472 4.0E-20
sp|Q0D9S3|HKT1_ORYSJ Cation transporter HKT1 OS=Oryza sativa subsp. japonica GN=HKT1 PE=1 SV=1 177 472 4.0E-20
sp|Q93XI5|HKT2_ORYSI Cation transporter HKT2 OS=Oryza sativa subsp. indica GN=HKT2 PE=1 SV=1 177 472 1.0E-17
sp|Q84TI7|HKT1_ARATH Sodium transporter HKT1 OS=Arabidopsis thaliana GN=HKT1 PE=1 SV=1 177 493 6.0E-16
sp|Q6H501|HKT6_ORYSJ Probable cation transporter HKT6 OS=Oryza sativa subsp. japonica GN=HKT6 PE=2 SV=1 184 472 2.0E-14
sp|Q7XPF8|HKT4_ORYSJ Cation transporter HKT4 OS=Oryza sativa subsp. japonica GN=HKT4 PE=1 SV=2 192 472 3.0E-13
sp|Q8L481|HKT3_ORYSJ Probable cation transporter HKT3 OS=Oryza sativa subsp. japonica GN=HKT3 PE=2 SV=1 181 472 2.0E-12
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 405 495 7.0E-12
sp|Q8L4K5|HKT9_ORYSJ Probable cation transporter HKT9 OS=Oryza sativa subsp. japonica GN=HKT9 PE=2 SV=1 181 472 8.0E-12
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 405 495 1.0E-10
sp|Q0JNB6|HKT8_ORYSJ Cation transporter HKT8 OS=Oryza sativa subsp. japonica GN=HKT8 PE=3 SV=1 208 496 7.0E-10
sp|A2WNZ9|HKT8_ORYSI Cation transporter HKT8 OS=Oryza sativa subsp. indica GN=HKT8 PE=2 SV=2 208 496 1.0E-09
sp|O31658|KTRD_BACSU Ktr system potassium uptake protein D OS=Bacillus subtilis (strain 168) GN=ktrD PE=3 SV=1 106 472 2.0E-07
sp|Q7XPF7|HKT7_ORYSJ Probable cation transporter HKT7 OS=Oryza sativa subsp. japonica GN=HKT7 PE=2 SV=2 330 472 2.0E-07
sp|O87953|KTRB_VIBAL Ktr system potassium uptake protein B OS=Vibrio alginolyticus GN=ktrB PE=1 SV=1 206 374 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0022857 transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 137 159 22
2 171 193 22
3 241 263 22
4 291 313 22
5 361 383 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1269
MTTENGPPAGFFILSSPNAGENGQLGCPDTSCDGMAFLCLEPCCPSYNKDFTETRYKVHMHSRGHTKAVSAGAIL
LQQQGLDAAEREARQESFRELRCAEPTNLALIDVVFTGASAATESGLSTVDCSTLPLYQQLYIYFIPIVTSAGFI
NCAVILVRLRCFRKSAGGNSSGNSSVYFFGIHLLGGSILAIWVKVADGKYAAYLEETGLNPTWWAFYTSQSAVNN
LGFTLTPDSMIHFRDAPFPLSLLGILGLLGASLYPVALRCLIWTLGQTSCFTSEVSYLLRHPRRCCTLLFPSGTT
YALLAIIVGLTAVDTLLIVVLDRDVKQVAGLSVGGRVAAAFFQAAASRHTGMSPYDLSEVTPAVQFSLLVMMYIS
SLPIALSIRSTTPQYDDQPLATYPPPPSYNEHRPATYLVQHAQQQLTSDLWPVFLTVFCLSVTEDSKLRDGGDPA
FALFPLLFEVVSGYNNVGISLGGGREVGGSLSERFSVLGKLVMCACHPPLEAN*
Coding >Ophun1|1269
ATGACGACGGAGAACGGCCCCCCAGCCGGCTTCTTCATCCTCTCGTCGCCCAACGCGGGCGAAAACGGCCAGCTC
GGCTGTCCGGACACGAGCTGCGACGGCATGGCGTTCCTATGCCTCGAACCGTGCTGTCCCTCCTACAACAAAGAC
TTCACGGAGACGCGGTACAAGGTGCACATGCACAGCCGCGGCCACACCAAAGCCGTCTCAGCCGGCGCCATCCTC
CTCCAACAGCAGGGCCTCGACGCAGCGGAGAGGGAGGCCAGGCAGGAGTCGTTCCGGGAGCTGCGGTGCGCGGAG
CCGACGAACTTGGCCTTGATCGACGTCGTCTTCACGGGCGCCAGCGCAGCAACAGAATCGGGTCTCAGCACTGTT
GACTGCAGTACGCTGCCGTTATACCAGCAGCTGTACATCTACTTCATCCCCATAGTCACGAGCGCGGGCTTCATC
AACTGCGCCGTGATTCTCGTGCGGTTGCGGTGCTTTCGGAAGAGTGCTGGAGGAAACTCTTCAGGAAACTCTTCT
GTTTACTTCTTCGGCATCCACCTCCTCGGCGGCTCCATCCTCGCCATCTGGGTCAAAGTCGCTGACGGAAAGTAC
GCGGCTTATCTTGAAGAGACGGGCCTCAACCCAACCTGGTGGGCCTTCTACACCTCCCAATCCGCAGTCAACAAC
CTCGGCTTCACTCTGACCCCCGACTCAATGATCCACTTCCGCGACGCCCCCTTCCCCCTCTCCCTCCTCGGAATC
CTAGGCCTCCTCGGCGCGTCTCTCTACCCCGTAGCCCTCCGCTGCCTCATCTGGACGCTCGGCCAGACGTCCTGC
TTCACGTCCGAGGTTTCCTACCTGCTGAGACACCCGCGACGGTGCTGCACGCTGCTGTTTCCTTCGGGGACGACG
TACGCGCTGCTGGCCATCATTGTTGGTCTGACTGCTGTTGATACGCTGCTTATTGTCGTGTTGGATAGGGATGTG
AAGCAGGTTGCTGGTCTTTCGGTTGGGGGGAGAGTTGCTGCTGCGTTTTTTCAGGCGGCTGCTTCGCGGCATACG
GGCATGTCGCCTTATGATCTTTCAGAGGTGACGCCAGCCGTACAATTCAGCCTCCTGGTCATGATGTACATCTCC
TCCCTCCCCATCGCCCTCAGCATCCGAAGCACAACCCCCCAATACGACGACCAACCGCTAGCAACCTACCCTCCC
CCCCCCTCCTACAACGAGCACCGCCCAGCAACCTACCTCGTGCAACACGCCCAGCAGCAACTGACCAGCGACCTC
TGGCCCGTCTTCCTCACCGTCTTCTGCCTGTCCGTCACCGAGGACAGCAAGCTCCGCGACGGGGGCGACCCGGCC
TTTGCGCTCTTCCCGCTGCTGTTCGAGGTGGTGTCTGGGTACAACAACGTGGGCATCTCGCTGGGGGGGGGGAGG
GAGGTTGGGGGCTCGTTGAGTGAGCGGTTTTCCGTGCTGGGGAAGCTGGTTATGTGTGCTTGTCATCCACCGCTG
GAAGCCAACTGA
Transcript >Ophun1|1269
ATGACGACGGAGAACGGCCCCCCAGCCGGCTTCTTCATCCTCTCGTCGCCCAACGCGGGCGAAAACGGCCAGCTC
GGCTGTCCGGACACGAGCTGCGACGGCATGGCGTTCCTATGCCTCGAACCGTGCTGTCCCTCCTACAACAAAGAC
TTCACGGAGACGCGGTACAAGGTGCACATGCACAGCCGCGGCCACACCAAAGCCGTCTCAGCCGGCGCCATCCTC
CTCCAACAGCAGGGCCTCGACGCAGCGGAGAGGGAGGCCAGGCAGGAGTCGTTCCGGGAGCTGCGGTGCGCGGAG
CCGACGAACTTGGCCTTGATCGACGTCGTCTTCACGGGCGCCAGCGCAGCAACAGAATCGGGTCTCAGCACTGTT
GACTGCAGTACGCTGCCGTTATACCAGCAGCTGTACATCTACTTCATCCCCATAGTCACGAGCGCGGGCTTCATC
AACTGCGCCGTGATTCTCGTGCGGTTGCGGTGCTTTCGGAAGAGTGCTGGAGGAAACTCTTCAGGAAACTCTTCT
GTTTACTTCTTCGGCATCCACCTCCTCGGCGGCTCCATCCTCGCCATCTGGGTCAAAGTCGCTGACGGAAAGTAC
GCGGCTTATCTTGAAGAGACGGGCCTCAACCCAACCTGGTGGGCCTTCTACACCTCCCAATCCGCAGTCAACAAC
CTCGGCTTCACTCTGACCCCCGACTCAATGATCCACTTCCGCGACGCCCCCTTCCCCCTCTCCCTCCTCGGAATC
CTAGGCCTCCTCGGCGCGTCTCTCTACCCCGTAGCCCTCCGCTGCCTCATCTGGACGCTCGGCCAGACGTCCTGC
TTCACGTCCGAGGTTTCCTACCTGCTGAGACACCCGCGACGGTGCTGCACGCTGCTGTTTCCTTCGGGGACGACG
TACGCGCTGCTGGCCATCATTGTTGGTCTGACTGCTGTTGATACGCTGCTTATTGTCGTGTTGGATAGGGATGTG
AAGCAGGTTGCTGGTCTTTCGGTTGGGGGGAGAGTTGCTGCTGCGTTTTTTCAGGCGGCTGCTTCGCGGCATACG
GGCATGTCGCCTTATGATCTTTCAGAGGTGACGCCAGCCGTACAATTCAGCCTCCTGGTCATGATGTACATCTCC
TCCCTCCCCATCGCCCTCAGCATCCGAAGCACAACCCCCCAATACGACGACCAACCGCTAGCAACCTACCCTCCC
CCCCCCTCCTACAACGAGCACCGCCCAGCAACCTACCTCGTGCAACACGCCCAGCAGCAACTGACCAGCGACCTC
TGGCCCGTCTTCCTCACCGTCTTCTGCCTGTCCGTCACCGAGGACAGCAAGCTCCGCGACGGGGGCGACCCGGCC
TTTGCGCTCTTCCCGCTGCTGTTCGAGGTGGTGTCTGGGTACAACAACGTGGGCATCTCGCTGGGGGGGGGGAGG
GAGGTTGGGGGCTCGTTGAGTGAGCGGTTTTCCGTGCTGGGGAAGCTGGTTATGTGTGCTTGTCATCCACCGCTG
GAAGCCAACTGA
Gene >Ophun1|1269
ATGACGACGGAGAACGGCCCCCCAGCCGGCTTCTTCATCCTCTCGTCGCCCAACGCGGGCGAAAACGGCCAGCTC
GGCTGTCCGGACACGAGCTGCGACGGCATGGCGTTCCTGTCCGCGGGCGAGTGCTAGCGGCACCTGCGCGAGTGG
CATTCTGGCGCCGAGTGCCGGGTCTGCGGCCTTCGGTTCGCGTCGGGCAGTGCGTTGGGGAGACATGTGAGGGCT
TCGGGGCATGCGGTTTGGCGGTGTTGTCGGGGGGGGTGTGAGGGGGAGGGGAGGGAGTTTGAGTCTTGTGTTGCG
TATCAGGCTCATGTTTTGGAGAGGCATGGGGGTTGTGGTGAGGCATGTGGTGAGAGTTGTGAAGACGACGACGAT
CTCTACCAGGAACTGGACAACACAGACACAACCAGAGACTCATCACCAAAACACCCCAAGACTCAGCAGCAAACC
CCCGACCCTCCCGCAGCAACCAGATGCCTCGAACCGTGCTGTCCCTCCTACAACAAAGACTTCACGGAGACGCGG
TACAAGGTGCACATGCACAGCCGCGGCCACACCAAAGCCGTCTCAGCCGGCGCCATCCTCCTCCAACAGCAGGGC
CTCGACGCAGCGGAGAGGGAGGCCAGGCAGGAGTCGTTCCGGGAGCTGCGGTGCGCGGAGCCGACGTGCGCCTTG
TTCCGTCATCGGATGGCCTCGTGCGGTGCCTTCTGGAGCCATTTGGATGTGCATGCTGACGCGGTTGTCGGCTGT
GGATGCAGGGGGGGTTGCATGTGCTGATGATGACGCTTGGCTGTGCTTTATACGAGCTGGGTGGAAGGGGATTCA
GGGGGGAGGGGATGGGGAGATGCTGGTATGTATAAGACGGTTGATGGGGGGAGAGCTCGTCCCGGGAATACATAC
GGATACAGAGGCGAGAGAGGGATTGCCGCGCACGTGTCTGGACCGTATCTACTCGCATGACGTCGAGGATCGACC
GTTATCTAGATTGAATCTGCGAGAGTTGACCTGCATGAGATGAGTTGAGATGTAAGGTAAGATGTAGTATCCCAG
TTCAACCGAAGATGGATAGAACATACCAAGAAGCGGTCGAGATGGCGGTCTGGCTAATACTTGAATGAGACTGGA
GGTGAGCCAGATATGATACACACCGGAAAAAGAAAGGTGAGGTGAGGTCGTTGAAGATGACCGAGGCCTGTCAAT
GTCATGGAAGCTCCACAACGCAGCCAAGAAGCCATCCTCACCTGTCAGGCTGTCAACCCTCTCCCCAGAATCCAA
CCGGCGCCTACTCCGAACCTCTCATGTCCAGTCCCATCAACCACTGTATAAAGCAACCCCTTGCATACCCGTCAC
TACATCTACACAGCAAACAAGCCCATCACACATCCCCTCAACACCATCCTCAACGTAGCACAACTCCCCCAACAC
CTGCCAGCGCAGTCCCCGTCTCGTGCCTCCAGCCCGTTCCCCCCCTGTCAGCGTCGCATCCGCCATACAGCCGGC
CGCATGACCGCCACCGCTGCGTCCTGCATGCGGTATCGCACAGCTTGGAGAGGCTGAGGCCGTTGTTGAAGATGC
GTCTCGGCCCGTATCCGTTGAGGGGAATGATGCACTTCATCTCGGTTGCTATATACATCTTGTGCTTCCCCCTTC
CCCCTTCCCTACCCCCCCCCCCTGTTGATTCTGCACATTTCACGTGTAAGTGGCTGATCAGCGGTGACGATGTGG
AAACCTGATGTTGGCTTTCTCGTCTATCATTGTGAGTTCTCTGGTTCTTCTTATGAAAAAGGGGGGGATTGCTGA
GAGGACAGATGGATGGGTTCTTGGCTGGGCCATCCTCGCGCTACCCCTTCTGGCGCCCTACAGGAACTTGGCCTT
GATCGACGTCGTCTTCACGGGCGCCAGCGCAGCAACAGAATCGGGTCTCAGCACTGTTGACTGCAGTACGCTGCC
GTTATACCAGCAGCTGTACATCTACTTCATCCCCATAGTCACGAGCGCGGGCTTCATCAACTGCGCCGTGATTCT
CGTGCGGTTGCGGTGCTTTCGGAAGAGGTTTGCTGGGGGGGAGGTTGAGGATGGGGGGCAGCGGGTTGAAGGGGA
GGTTGAGGATGGGCAGCGGCATGAGAGGGGGGTTGAAGATGGGATGAGTTTGGAGAGGGTTGGGGAGAAAGGGGG
TGAAGGGAAGAAGATGGAGGGACAATCTGATGTCAGTGCTGGAGGAAACTCTTCAGGAAACTCTTCTGGTTTGTT
ACTCGCAACTCAGTCTTCAACCTTCGACTCTAATACTGACAGACACGACGCCCACCACAGACAACCCCCCCGTCA
AACCAACACCCACCAACCACTCCCATGACCAAACCTCCAAAGAGAGAAACGAACTGGGCGGCATCGAATACCGCA
GTCTCAAACTCCTCCTCGCCATCACAGCCGGCAAGAGCCCCCCATTCTCACCATCCCTACTTCGCTCTCTCCCGC
TCTCTAACCTTTCATCGCGACAGTTTACTTCTTCGGCATCCACCTCCTCGGCGGCTCCATCCTCGCCATCTGGGT
CAAAGTCGCTGACGGAAAGTACGCGGCTTATCTTGAAGAGACGGGCCTCAACCCAACCTGGTGGTACGACTCCCC
TGCCCATGTCCCCTTTCAACACTTCATCTAAGTATATCAAACCCAGGGCCTTCTACACCTCCCAATCCGCAGTCA
ACAACCTCGGCTTCACTCTGACCCCCGACTCAATGATCCACTTCCGCGACGCCCCCTTCCCCCTCTCCCTCCTCG
GAATCCTAGGCCTCCTCGGCGCGTCTCTCTACCCCGTAGCCCTCCGCTGCCTCATCTGGACGCTCGGCCAGACGT
CCTGCTTCACGTCCGAGGTTTCCTACCTGCTGAGACACCCGCGACGGTGCTGCACGCTGCTGTTTCCTTCGGGGA
CGACGTACGCGCTGCTGGCCATCATTGTTGGTCTGACTGCTGTTGATACGCTGCTTATTGTCGTGTTGGATAGGG
ATGTGAAGCAGGTTGCTGGTCTTTCGGTTGGGGGGAGAGTTGCTGCTGCGTTTTTTCAGGCGGCTGCTTCGCGGC
ATACGGGCATGTCGCCTTATGATCTTTCAGAGGTGACGCCAGCCGTACAATTCAGGTTCGTACATTCATCTAATG
TTCTCTTTCAAACATAACTGACAAAGCACCAGCCTCCTGGTCATGATGTACATCTCCTCCCTCCCCATCGCCCTC
AGCATCCGAAGCACAACCCCCCAATACGACGACCAACCGCTAGCAACCTACCCTCCCCCCCCCTCCTACAACGAG
CACCGCCCAGCAACCTACCTCGTGCAACACGCCCAGCAGCAACTGACCAGCGACCTCTGGCCCGTCTTCCTCACC
GTCTTCTGCCTGTCCGTCACCGAGGACAGCAAGCTCCGCGACGGGGGCGACCCGGCCTTTGCGCTCTTCCCGCTG
CTGTTCGAGGTGGTGTCTGGGTACAACAACGTGGGCATCTCGCTGGGGGGGGGGAGGGAGGTTGGGGGCTCGTTG
AGTGAGCGGTTTTCCGTGCTGGGGAAGCTGGTTATGTGTGCTTGTATGCTGAGGGGGAGGCATAGGGGGTTGCCG
GTGAGGATTGACAGGGGGGTTTTGTTGGCGGGGGAGAGGTGAGGGTGGATGGAGGGTGTGTGGACATGAACAGAC
GTCAATAGTTGCGTGTGTGATAACATAGAGTACGAATGTGTATAGAAACATGAAAACTCGTTTGCGGAACTGGTG
ATGCGCTGTCGTGGGGGCTGGCTGTAGAGCTCGACGTGGCGGCATGTTGTGTCACTGTCTGTGGTCAGATGGTTG
GACGCCGGAAGCATAAACCTCTTCATCACCGGCATCTCGGGAGCCGGAGACACCATCTCAAGGTCATCCACCGCT
GGAAGCCAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail