Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1265
Gene name
LocationContig_15:20657..23712
Strand+
Gene length (bp)3055
Transcript length (bp)1941
Coding sequence length (bp)1941
Protein length (aa) 647

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 2.6E-07 4 66
PF00743 FMO-like Flavin-binding monooxygenase-like 2.7E-35 66 334
PF02560 Cyanate_lyase Cyanate lyase C-terminal domain 2.9E-27 538 601
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 5.1E-11 8 191
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.9E-10 5 200
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 1.4E-07 68 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B6Q2W9|CYNS_TALMQ Cyanate hydratase OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=cyn1 PE=3 SV=1 456 607 1.0E-66
sp|B8MQZ4|CYNS_TALSN Cyanate hydratase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=cyn1 PE=3 SV=1 456 605 2.0E-64
sp|B8NQ08|CYNS_ASPFN Cyanate hydratase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cyn1 PE=3 SV=1 456 605 2.0E-64
sp|A2R692|CYNS_ASPNC Cyanate hydratase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cyn1 PE=3 SV=1 456 605 3.0E-64
sp|A1C7Y5|CYNS_ASPCL Cyanate hydratase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cyn1 PE=3 SV=1 456 601 4.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B6Q2W9|CYNS_TALMQ Cyanate hydratase OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=cyn1 PE=3 SV=1 456 607 1.0E-66
sp|B8MQZ4|CYNS_TALSN Cyanate hydratase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=cyn1 PE=3 SV=1 456 605 2.0E-64
sp|B8NQ08|CYNS_ASPFN Cyanate hydratase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cyn1 PE=3 SV=1 456 605 2.0E-64
sp|A2R692|CYNS_ASPNC Cyanate hydratase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cyn1 PE=3 SV=1 456 605 3.0E-64
sp|A1C7Y5|CYNS_ASPCL Cyanate hydratase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cyn1 PE=3 SV=1 456 601 4.0E-64
sp|Q2UAX9|CYNS_ASPOR Cyanate hydratase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyn1 PE=3 SV=1 456 605 5.0E-64
sp|Q0CVK8|CYNS_ASPTN Cyanate hydratase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cyn1 PE=3 SV=1 456 601 4.0E-63
sp|B0XV83|CYNS_ASPFC Cyanate hydratase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cyn1 PE=3 SV=1 456 601 6.0E-62
sp|Q4WZL3|CYNS_ASPFU Cyanate hydratase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyn1 PE=3 SV=1 456 601 8.0E-62
sp|C8VCM2|CYNS_EMENI Cyanate hydratase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyn1 PE=3 SV=2 456 607 9.0E-62
sp|A1DIL2|CYNS_NEOFI Cyanate hydratase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cyn1 PE=3 SV=1 456 607 3.0E-61
sp|B6HIM5|CYNS_PENRW Cyanate hydratase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=cyn1 PE=3 SV=1 456 607 4.0E-61
sp|C5JJW0|CYNS_AJEDS Cyanate hydratase OS=Ajellomyces dermatitidis (strain SLH14081) GN=CYN1 PE=3 SV=1 456 603 9.0E-61
sp|C5G6H8|CYNS_AJEDR Cyanate hydratase OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=CYN1 PE=3 SV=1 456 603 9.0E-61
sp|C5PDS9|CYNS_COCP7 Cyanate hydratase OS=Coccidioides posadasii (strain C735) GN=CYN1 PE=3 SV=1 456 601 1.0E-60
sp|C6HBW5|CYNS_AJECH Cyanate hydratase OS=Ajellomyces capsulatus (strain H143) GN=CYN1 PE=3 SV=1 456 601 2.0E-60
sp|A6R853|CYNS_AJECN Cyanate hydratase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=CYN1 PE=3 SV=1 456 601 3.0E-60
sp|C0NWE3|CYNS_AJECG Cyanate hydratase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CYN1 PE=3 SV=1 456 601 5.0E-60
sp|C4JUN6|CYNS_UNCRE Cyanate hydratase OS=Uncinocarpus reesii (strain UAMH 1704) GN=CYN1 PE=3 SV=1 459 601 1.0E-59
sp|C1H765|CYNS_PARBA Cyanate hydratase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=CYN1 PE=3 SV=1 456 601 1.0E-58
sp|C1FZ35|CYNS_PARBD Cyanate hydratase OS=Paracoccidioides brasiliensis (strain Pb18) GN=CYN1 PE=3 SV=1 456 601 1.0E-57
sp|C0S4M2|CYNS_PARBP Cyanate hydratase OS=Paracoccidioides brasiliensis (strain Pb03) GN=CYN1 PE=3 SV=1 456 601 2.0E-57
sp|A6S6V7|CYNS_BOTFB Cyanate hydratase OS=Botryotinia fuckeliana (strain B05.10) GN=cyn1 PE=3 SV=1 461 607 3.0E-56
sp|A7F1L5|CYNS_SCLS1 Cyanate hydratase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cyn1 PE=3 SV=1 461 607 6.0E-56
sp|C5FMD4|CYNS_ARTOC Cyanate hydratase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CYN1 PE=3 SV=1 456 601 2.0E-55
sp|A4R2S1|CYNS_MAGO7 Cyanate hydratase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CYN1 PE=3 SV=2 461 601 3.0E-55
sp|Q0UBT2|CYNS_PHANO Cyanate hydratase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CYN1 PE=3 SV=3 459 602 2.0E-54
sp|B2B4S6|CYNS_PODAN Cyanate hydratase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CYN1 PE=3 SV=1 461 601 4.0E-54
sp|Q871Z4|CYNS_NEUCR Cyanate hydratase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyn1 PE=3 SV=1 461 601 5.0E-53
sp|D1ZHN6|CYNS_SORMK Cyanate hydratase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=CYN1 PE=1 SV=2 443 601 1.0E-52
sp|C7YTF5|CYNS_NECH7 Cyanate hydratase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=CYN1 PE=3 SV=1 461 605 3.0E-52
sp|Q4JJB1|CYNS_CHAGS Cyanate hydratase OS=Chaetomium globosum GN=CYN1 PE=2 SV=1 456 607 1.0E-50
sp|B2WIX9|CYNS_PYRTR Cyanate hydratase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cyn1 PE=3 SV=2 458 607 3.0E-50
sp|C9S8A7|CYNS_VERA1 Cyanate hydratase OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=CYN1 PE=3 SV=1 461 602 3.0E-47
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 1 488 3.0E-43
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 1 415 5.0E-43
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 5 418 2.0E-42
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 5 418 2.0E-42
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 5 418 3.0E-42
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 5 418 1.0E-41
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 5 418 2.0E-41
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 5 423 2.0E-41
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 1 415 3.0E-40
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 5 418 7.0E-40
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 1 415 8.0E-40
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 5 423 2.0E-39
sp|P31513|FMO3_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Homo sapiens GN=FMO3 PE=1 SV=5 5 335 4.0E-39
sp|Q7YS44|FMO3_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Pan troglodytes GN=FMO3 PE=3 SV=3 5 335 6.0E-39
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 5 434 4.0E-38
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 5 417 6.0E-38
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 5 423 1.0E-37
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 5 416 4.0E-37
sp|P32417|FMO3_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Oryctolagus cuniculus GN=FMO3 PE=1 SV=3 5 429 5.0E-37
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 5 335 2.0E-36
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 5 431 3.0E-36
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 1 415 7.0E-36
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 5 335 8.0E-36
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 3 417 8.0E-36
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 5 431 1.0E-35
sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus GN=FMO3 PE=2 SV=1 5 429 6.0E-35
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 3 411 2.0E-34
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 5 417 7.0E-34
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 5 417 1.0E-31
sp|P16549|FMO1_PIG Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Sus scrofa GN=FMO1 PE=1 SV=3 5 243 1.0E-29
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 5 243 2.0E-29
sp|P17636|FMO1_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Oryctolagus cuniculus GN=FMO1 PE=1 SV=3 5 243 7.0E-29
sp|A8NV38|CYNS_COPC7 Cyanate hydratase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CYN1 PE=3 SV=2 459 601 1.0E-28
sp|P58703|CYNS_NOSS1 Cyanate hydratase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cynS PE=3 SV=1 460 601 2.0E-28
sp|B0DN41|CYNS_LACBS Cyanate hydratase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=CYN1 PE=3 SV=1 456 601 2.0E-28
sp|Q4PD40|CYNS_USTMA Cyanate hydratase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYN1 PE=3 SV=2 458 602 4.0E-28
sp|Q3M8R1|CYNS_ANAVT Cyanate hydratase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=cynS PE=3 SV=1 460 601 1.0E-27
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 5 241 2.0E-27
sp|Q0I634|CYNS_SYNS3 Cyanate hydratase OS=Synechococcus sp. (strain CC9311) GN=cynS PE=3 SV=1 462 601 1.0E-26
sp|Q46I00|CYNS_PROMT Cyanate hydratase OS=Prochlorococcus marinus (strain NATL2A) GN=cynS PE=3 SV=1 460 601 4.0E-25
sp|Q7U3E2|CYNS_SYNPX Cyanate hydratase OS=Synechococcus sp. (strain WH8102) GN=cynS PE=3 SV=1 463 601 1.0E-24
sp|Q7V2U0|CYNS_PROMP Cyanate hydratase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=cynS PE=3 SV=1 460 601 5.0E-24
sp|A2BZH4|CYNS_PROM1 Cyanate hydratase OS=Prochlorococcus marinus (strain NATL1A) GN=cynS PE=3 SV=1 460 601 1.0E-23
sp|P0CN02|CYNS_CRYNJ Cyanate hydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYN1 PE=3 SV=1 460 601 1.0E-23
sp|P0CN03|CYNS_CRYNB Cyanate hydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYN1 PE=3 SV=1 460 601 1.0E-23
sp|Q5N0J1|CYNS_SYNP6 Cyanate hydratase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cynS PE=3 SV=1 468 601 2.0E-23
sp|Q59948|CYNS_SYNE7 Cyanate hydratase OS=Synechococcus elongatus (strain PCC 7942) GN=cynS PE=1 SV=1 468 601 2.0E-23
sp|Q55367|CYNS_SYNY3 Cyanate hydratase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cynS PE=1 SV=1 468 601 2.0E-23
sp|B0C8H2|CYNS_ACAM1 Cyanate hydratase OS=Acaryochloris marina (strain MBIC 11017) GN=cynS PE=3 SV=1 468 601 1.0E-22
sp|Q47G40|CYNS_DECAR Cyanate hydratase OS=Dechloromonas aromatica (strain RCB) GN=cynS PE=3 SV=1 465 602 4.0E-21
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 8 221 8.0E-20
sp|Q3SHJ2|CYNS_THIDA Cyanate hydratase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=cynS PE=3 SV=1 467 607 2.0E-19
sp|B1JA05|CYNS_PSEPW Cyanate hydratase OS=Pseudomonas putida (strain W619) GN=cynS PE=3 SV=1 465 602 2.0E-19
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 2 326 3.0E-19
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 7 326 9.0E-19
sp|Q9FWW6|GSXL1_ARATH Flavin-containing monooxygenase FMO GS-OX-like 1 OS=Arabidopsis thaliana GN=At1g12160 PE=2 SV=1 6 188 1.0E-18
sp|Q48GB5|CYNS_PSE14 Cyanate hydratase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=cynS PE=3 SV=1 468 602 1.0E-18
sp|A5W5F5|CYNS_PSEP1 Cyanate hydratase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cynS PE=3 SV=1 467 601 2.0E-18
sp|A3NDL7|CYNS_BURP6 Cyanate hydratase OS=Burkholderia pseudomallei (strain 668) GN=cynS PE=3 SV=1 441 602 3.0E-18
sp|A1V0I2|CYNS_BURMS Cyanate hydratase OS=Burkholderia mallei (strain SAVP1) GN=cynS PE=3 SV=1 441 602 3.0E-18
sp|Q62H08|CYNS_BURMA Cyanate hydratase OS=Burkholderia mallei (strain ATCC 23344) GN=cynS PE=3 SV=1 441 602 3.0E-18
sp|A2S5L0|CYNS_BURM9 Cyanate hydratase OS=Burkholderia mallei (strain NCTC 10229) GN=cynS PE=3 SV=1 441 602 3.0E-18
sp|A3MRF1|CYNS_BURM7 Cyanate hydratase OS=Burkholderia mallei (strain NCTC 10247) GN=cynS PE=3 SV=1 441 602 3.0E-18
sp|Q4ZQQ7|CYNS_PSEU2 Cyanate hydratase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cynS PE=3 SV=1 468 602 4.0E-18
sp|A1T8R2|CYNS_MYCVP Cyanate hydratase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cynS PE=3 SV=1 468 602 4.0E-18
sp|A6W1Q1|CYNS_MARMS Cyanate hydratase OS=Marinomonas sp. (strain MWYL1) GN=cynS PE=3 SV=1 468 601 4.0E-18
sp|B2UK94|CYNS_RALPJ Cyanate hydratase OS=Ralstonia pickettii (strain 12J) GN=cynS PE=3 SV=1 467 607 5.0E-18
sp|Q2SZA4|CYNS_BURTA Cyanate hydratase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=cynS PE=3 SV=1 472 601 6.0E-18
sp|B4EJC2|CYNS_BURCJ Cyanate hydratase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=cynS PE=3 SV=1 471 602 1.0E-17
sp|A0AXK2|CYNS_BURCH Cyanate hydratase OS=Burkholderia cenocepacia (strain HI2424) GN=cynS PE=3 SV=1 471 602 1.0E-17
sp|B1K759|CYNS_BURCC Cyanate hydratase OS=Burkholderia cenocepacia (strain MC0-3) GN=cynS PE=3 SV=1 471 602 1.0E-17
sp|Q1BL48|CYNS_BURCA Cyanate hydratase OS=Burkholderia cenocepacia (strain AU 1054) GN=cynS PE=3 SV=1 471 602 1.0E-17
sp|Q885A6|CYNS_PSESM Cyanate hydratase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cynS PE=3 SV=1 468 602 2.0E-17
sp|Q391E0|CYNS_BURL3 Cyanate hydratase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=cynS PE=3 SV=1 471 602 2.0E-17
sp|A4JRR6|CYNS_BURVG Cyanate hydratase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=cynS PE=3 SV=1 471 601 2.0E-17
sp|A8GBZ7|CYNS_SERP5 Cyanate hydratase OS=Serratia proteamaculans (strain 568) GN=cynS PE=1 SV=1 460 601 3.0E-17
sp|Q7NWU9|CYNS_CHRVO Cyanate hydratase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cynS PE=3 SV=1 454 601 4.0E-17
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 6 190 4.0E-17
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 8 200 4.0E-17
sp|O66587|CYNS_AQUAE Cyanate hydratase OS=Aquifex aeolicus (strain VF5) GN=cynS PE=3 SV=1 465 601 6.0E-17
sp|Q63QS4|CYNS_BURPS Cyanate hydratase OS=Burkholderia pseudomallei (strain K96243) GN=cynS PE=3 SV=1 471 601 6.0E-17
sp|A3NZD0|CYNS_BURP0 Cyanate hydratase OS=Burkholderia pseudomallei (strain 1106a) GN=cynS PE=3 SV=1 471 601 6.0E-17
sp|Q0B2Y2|CYNS_BURCM Cyanate hydratase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=cynS PE=3 SV=1 471 601 6.0E-17
sp|B1Z5U9|CYNS_BURA4 Cyanate hydratase OS=Burkholderia ambifaria (strain MC40-6) GN=cynS PE=3 SV=1 471 601 6.0E-17
sp|P00816|CYNS_ECOLI Cyanate hydratase OS=Escherichia coli (strain K12) GN=cynS PE=1 SV=2 468 601 7.0E-17
sp|B1XBI8|CYNS_ECODH Cyanate hydratase OS=Escherichia coli (strain K12 / DH10B) GN=cynS PE=3 SV=1 468 601 7.0E-17
sp|Q972W5|CYNS_SULTO Cyanate hydratase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cynS PE=3 SV=1 472 605 7.0E-17
sp|B7N8P7|CYNS_ECOLU Cyanate hydratase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cynS PE=3 SV=1 468 601 7.0E-17
sp|B5Z2P3|CYNS_ECO5E Cyanate hydratase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cynS PE=3 SV=1 468 601 7.0E-17
sp|P58704|CYNS_ECO57 Cyanate hydratase OS=Escherichia coli O157:H7 GN=cynS PE=3 SV=1 468 601 7.0E-17
sp|B1LIM5|CYNS_ECOSM Cyanate hydratase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cynS PE=3 SV=1 468 601 8.0E-17
sp|B6HZW6|CYNS_ECOSE Cyanate hydratase OS=Escherichia coli (strain SE11) GN=cynS PE=3 SV=1 468 601 8.0E-17
sp|B7M2Y9|CYNS_ECO8A Cyanate hydratase OS=Escherichia coli O8 (strain IAI1) GN=cynS PE=3 SV=1 468 601 8.0E-17
sp|B7NK15|CYNS_ECO7I Cyanate hydratase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cynS PE=3 SV=1 468 601 8.0E-17
sp|B7L4Z6|CYNS_ECO55 Cyanate hydratase OS=Escherichia coli (strain 55989 / EAEC) GN=cynS PE=3 SV=1 468 601 8.0E-17
sp|A7ZI88|CYNS_ECO24 Cyanate hydratase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cynS PE=3 SV=1 468 601 8.0E-17
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 6 190 9.0E-17
sp|Q1I7P9|CYNS_PSEE4 Cyanate hydratase OS=Pseudomonas entomophila (strain L48) GN=cynS PE=3 SV=1 465 601 1.0E-16
sp|A9TND9|CYNS_PHYPA Cyanate hydratase OS=Physcomitrella patens subsp. patens GN=CYN PE=3 SV=1 458 601 1.0E-16
sp|B1J0T9|CYNS_ECOLC Cyanate hydratase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cynS PE=3 SV=1 468 601 2.0E-16
sp|C5BUK2|CYNS_TERTT Cyanate hydratase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cynS PE=3 SV=1 471 601 2.0E-16
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 7 338 2.0E-16
sp|Q0K572|CYNS_CUPNH Cyanate hydratase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cynS PE=3 SV=1 467 607 4.0E-16
sp|A7ZWY8|CYNS_ECOHS Cyanate hydratase OS=Escherichia coli O9:H4 (strain HS) GN=cynS PE=3 SV=1 468 601 4.0E-16
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 7 326 4.0E-16
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 8 221 5.0E-16
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 7 326 5.0E-16
sp|B1ME90|CYNS_MYCA9 Cyanate hydratase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=cynS PE=3 SV=1 471 602 2.0E-15
sp|B7FRE8|CYNS_PHATC Cyanate hydratase OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=CYN PE=3 SV=1 468 601 2.0E-15
sp|Q4KGL6|CYNS_PSEF5 Cyanate hydratase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cynS PE=3 SV=1 454 601 2.0E-15
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 8 200 2.0E-15
sp|P61192|CYNS_MYCPA Cyanate hydratase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cynS PE=3 SV=1 468 602 2.0E-15
sp|A0QL81|CYNS_MYCA1 Cyanate hydratase OS=Mycobacterium avium (strain 104) GN=cynS PE=3 SV=1 468 602 2.0E-15
sp|Q7NA33|CYNS_PHOLL Cyanate hydratase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cynS PE=3 SV=1 450 601 2.0E-15
sp|Q9FLK4|GSXL8_ARATH Flavin-containing monooxygenase FMO GS-OX-like 8 OS=Arabidopsis thaliana GN=At5g61290 PE=2 SV=1 6 190 8.0E-15
sp|A2SLJ8|CYNS_METPP Cyanate hydratase OS=Methylibium petroleiphilum (strain PM1) GN=cynS PE=3 SV=1 468 601 9.0E-15
sp|Q9HFE4|FMO1_SCHPO Thiol-specific monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmo1 PE=1 SV=1 5 200 2.0E-14
sp|A6V6B1|CYNS_PSEA7 Cyanate hydratase OS=Pseudomonas aeruginosa (strain PA7) GN=cynS PE=3 SV=1 526 602 3.0E-14
sp|C5WYI7|CYNS_SORBI Cyanate hydratase OS=Sorghum bicolor GN=CYN PE=3 SV=1 468 601 3.0E-14
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 6 190 4.0E-14
sp|B5YM03|CYNS_THAPS Cyanate hydratase OS=Thalassiosira pseudonana GN=CYN PE=3 SV=1 427 601 4.0E-14
sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 5 190 4.0E-14
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 4 334 5.0E-14
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 6 326 5.0E-14
sp|O22683|CYNS_ARATH Cyanate hydratase OS=Arabidopsis thaliana GN=CYN PE=2 SV=1 468 608 5.0E-14
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 5 190 7.0E-14
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 4 174 7.0E-14
sp|Q9I263|CYNS_PSEAE Cyanate hydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cynS PE=3 SV=1 526 602 7.0E-14
sp|B7VA51|CYNS_PSEA8 Cyanate hydratase OS=Pseudomonas aeruginosa (strain LESB58) GN=cynS PE=3 SV=1 526 602 7.0E-14
sp|Q02LK0|CYNS_PSEAB Cyanate hydratase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cynS PE=3 SV=1 491 602 8.0E-14
sp|B6TTW1|CYNS_MAIZE Cyanate hydratase OS=Zea mays GN=CYN PE=2 SV=1 468 601 8.0E-14
sp|Q93Y23|GSOX4_ARATH Flavin-containing monooxygenase FMO GS-OX4 OS=Arabidopsis thaliana GN=FMOGS-OX4 PE=2 SV=1 1 194 9.0E-14
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 6 190 1.0E-13
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 8 328 1.0E-13
sp|Q94K43|GSOX2_ARATH Flavin-containing monooxygenase FMO GS-OX2 OS=Arabidopsis thaliana GN=FMOGS-OX2 PE=2 SV=1 6 190 2.0E-13
sp|Q9FWK4|CYNS_ORYSJ Cyanate hydratase OS=Oryza sativa subsp. japonica GN=CYN PE=2 SV=2 468 601 3.0E-13
sp|A2Z8F9|CYNS_ORYSI Cyanate hydratase OS=Oryza sativa subsp. indica GN=CYN PE=3 SV=1 468 601 3.0E-13
sp|A4SXJ6|CYNS_POLSQ Cyanate hydratase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=cynS PE=3 SV=1 468 607 2.0E-12
sp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=2 SV=1 3 200 3.0E-12
sp|A8MRX0|GSOX5_ARATH Flavin-containing monooxygenase FMO GS-OX5 OS=Arabidopsis thaliana GN=FMOGS-OX5 PE=2 SV=2 1 190 4.0E-12
sp|Q1GZA1|CYNS_METFK Cyanate hydratase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=cynS PE=3 SV=1 468 601 4.0E-12
sp|Q9FWW3|GSXL6_ARATH Flavin-containing monooxygenase FMO GS-OX-like 6 OS=Arabidopsis thaliana GN=At1g12130 PE=2 SV=1 5 186 5.0E-12
sp|C5CRQ4|CYNS_VARPS Cyanate hydratase OS=Variovorax paradoxus (strain S110) GN=cynS PE=3 SV=1 468 601 7.0E-12
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 2 186 7.0E-12
sp|C6SXE1|CYNS_SOYBN Cyanate hydratase OS=Glycine max GN=CYN PE=2 SV=1 468 601 3.0E-11
sp|B9T3R0|CYNS_RICCO Cyanate hydratase OS=Ricinus communis GN=CYN PE=3 SV=1 468 601 3.0E-11
sp|B7FKW7|CYNS_MEDTR Cyanate hydratase OS=Medicago truncatula GN=CYN PE=2 SV=1 478 601 4.0E-11
sp|Q94BV5|GSXL4_ARATH Flavin-containing monooxygenase FMO GS-OX-like 4 OS=Arabidopsis thaliana GN=At1g62600 PE=2 SV=1 6 190 4.0E-11
sp|A5BJL8|CYNS_VITVI Cyanate hydratase OS=Vitis vinifera GN=CYN PE=3 SV=1 521 601 5.0E-11
sp|Q12GT8|CYNS_POLSJ Cyanate hydratase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=cynS PE=3 SV=1 468 601 8.0E-11
sp|B9HSR7|CYNS_POPTR Cyanate hydratase OS=Populus trichocarpa GN=CYN PE=3 SV=1 468 601 2.0E-10
sp|Q21S14|CYNS_RHOFT Cyanate hydratase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=cynS PE=3 SV=1 530 601 3.0E-10
sp|Q9FKE7|FMO2_ARATH Putative flavin-containing monooxygenase 2 OS=Arabidopsis thaliana GN=FMO2 PE=3 SV=2 5 328 5.0E-09
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 5 171 2.0E-08
sp|P12015|CHMO_ACISP Cyclohexanone 1,2-monooxygenase OS=Acinetobacter sp. PE=1 SV=2 8 185 2.0E-08
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 6 196 7.0E-07
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 6 196 7.0E-07
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 6 196 7.0E-07
sp|Q9SXD9|GSXL7_ARATH Flavin-containing monooxygenase FMO GS-OX-like 7 OS=Arabidopsis thaliana GN=At1g62580 PE=3 SV=2 6 190 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009439 cyanate metabolic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0050661 NADP binding Yes
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0006082 organic acid metabolic process No
GO:0004497 monooxygenase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0000166 nucleotide binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup410
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6712
Ophiocordyceps australis map64 (Brazil) OphauB2|6202
Ophiocordyceps camponoti-floridani Ophcf2|03398
Ophiocordyceps camponoti-rufipedis Ophun1|1265 (this protein)
Ophiocordyceps kimflemingae Ophio5|1984
Ophiocordyceps kimflemingae Ophio5|1985
Ophiocordyceps subramaniannii Hirsu2|2331

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1265
MEKMKIAIIGLGPAGLTALKCLREEGFDAVALERRSEVGGVWSYSADGSYTSVIGETVSNISKFVMAAYMQSYAQ
NFNLEPYMHFNTTVTHVKRNPSNTAWTITFTLPSGTPQSLHFDKVVFSTGSERLPLWPSLPGHQTFTGQILHGQS
YRCPEAFAGRRVLVVGMGNTACDVSLSLTRHASHVYQSYRRGRTVLSRYLDNGLPTDTLMTWPLLRLKYFLDAKI
PSLSRLVVDTLVKRKMVSDAARQETSKSKASARRRLQTWRLLDGPSLSHTHPAVQEDFLSALYDESVVPVSGFRA
FVGADAVLLEDGTVIRADAVIFCTGYSNGFSIMPELEMDGACRLPPQTALDAETDQSTSSQPHLPRLYQMMFPPK
HASSIAFLSWMAPQQSVWTVAELASTALSQIWASQTTPPTPNTRPATLPPEAKMEAWVDGYHSWWRSQHAREPSM
RSGLQSQLPSLPSSSPLLFAAKTAKKLTFSQLATLLHRSEVATAAIFYGQARASEEDISALAHALDIPRAQLVEA
LPEFPDRGRSVEMPPRDPLIYRLFEVVQNYGYAYKAVLNEKFGDGIMSGVCFSTDVQKETDKDGADWAVITMKGK
WCVLSFYRPVDGEPLKLMVVVVEAAFFEVLILLQQPEWSAYLTHRS*
Coding >Ophun1|1265
ATGGAAAAGATGAAAATCGCAATCATCGGTCTCGGCCCTGCCGGCTTGACAGCGCTGAAGTGCCTGCGGGAAGAG
GGCTTCGACGCCGTCGCGCTGGAGAGGCGGAGCGAGGTGGGCGGCGTGTGGTCGTACAGCGCCGACGGGAGTTAC
ACGTCTGTGATTGGGGAGACGGTCTCTAATATCAGCAAGTTTGTGATGGCAGCATACATGCAATCCTACGCCCAA
AACTTCAACCTCGAGCCCTACATGCACTTCAACACCACCGTCACGCACGTCAAACGCAACCCTTCCAACACAGCA
TGGACCATCACCTTCACCCTCCCCTCCGGAACCCCCCAATCCCTCCACTTCGACAAGGTCGTCTTCAGCACCGGC
TCCGAAAGACTCCCCCTCTGGCCCTCCCTCCCCGGCCACCAGACCTTCACCGGCCAGATCCTCCACGGCCAGAGC
TACCGCTGCCCAGAGGCCTTTGCGGGGAGGCGCGTGCTGGTGGTTGGCATGGGGAACACCGCCTGCGATGTATCT
CTCAGTCTTACACGCCACGCCTCTCACGTCTACCAGTCCTACCGCCGCGGTCGAACCGTGCTGTCGCGATACCTG
GACAACGGCCTTCCCACCGATACGCTCATGACGTGGCCACTCCTCCGGCTGAAATACTTCCTAGACGCCAAGATC
CCATCCCTTTCGCGCCTCGTTGTCGATACGCTGGTCAAGCGCAAGATGGTCTCTGACGCAGCGCGCCAAGAAACA
TCCAAGTCCAAGGCCTCCGCGCGACGAAGATTGCAAACATGGCGACTCCTCGATGGACCGAGTCTCTCCCACACC
CATCCCGCTGTGCAGGAAGACTTCCTGTCCGCGCTGTACGATGAAAGCGTGGTGCCCGTGTCCGGCTTCCGGGCG
TTTGTGGGAGCGGATGCCGTCTTGCTCGAGGACGGGACCGTGATTCGTGCGGATGCCGTCATCTTCTGCACGGGA
TATTCCAACGGCTTCAGCATCATGCCTGAGCTGGAGATGGATGGAGCCTGCCGTCTCCCCCCCCAAACCGCCCTC
GACGCCGAAACCGACCAAAGCACATCTTCACAACCTCACCTCCCGCGCCTCTACCAGATGATGTTCCCCCCCAAA
CACGCCTCCTCAATCGCCTTCCTCAGCTGGATGGCCCCCCAGCAAAGCGTCTGGACCGTCGCAGAACTCGCCTCC
ACAGCCCTCTCCCAAATCTGGGCCTCCCAAACCACCCCCCCCACGCCCAACACCCGCCCTGCAACCCTCCCGCCC
GAGGCCAAGATGGAAGCCTGGGTAGACGGCTACCACAGCTGGTGGCGGTCCCAGCACGCGCGCGAGCCGTCGATG
CGCTCCGGCCTCCAATCGCAGCTCCCCTCCCTCCCCTCCAGCAGCCCCCTCCTCTTCGCCGCCAAAACAGCAAAG
AAGCTGACCTTCAGCCAACTCGCCACCCTCCTCCACCGCTCCGAAGTCGCCACCGCTGCCATCTTCTACGGCCAA
GCCCGCGCCTCGGAGGAGGACATTTCCGCCCTGGCCCACGCCCTCGACATCCCCCGCGCCCAGCTCGTCGAGGCC
CTCCCCGAATTCCCCGATCGCGGCCGCAGCGTCGAGATGCCGCCGAGGGATCCCCTCATCTATCGCTTGTTCGAG
GTGGTGCAGAACTATGGCTATGCTTACAAGGCGGTTTTGAATGAAAAGTTTGGCGATGGCATTATGAGTGGCGTT
TGCTTCTCTACTGATGTTCAGAAGGAGACGGACAAGGACGGTGCCGACTGGGCTGTCATTACCATGAAGGGTAAA
TGGTGCGTTCTCTCTTTCTACCGACCTGTTGACGGCGAGCCCTTGAAGCTGATGGTGGTCGTTGTCGAGGCTGCC
TTTTTCGAGGTTTTGATCCTGCTGCAACAGCCAGAATGGAGTGCCTACCTGACACATCGGTCATGA
Transcript >Ophun1|1265
ATGGAAAAGATGAAAATCGCAATCATCGGTCTCGGCCCTGCCGGCTTGACAGCGCTGAAGTGCCTGCGGGAAGAG
GGCTTCGACGCCGTCGCGCTGGAGAGGCGGAGCGAGGTGGGCGGCGTGTGGTCGTACAGCGCCGACGGGAGTTAC
ACGTCTGTGATTGGGGAGACGGTCTCTAATATCAGCAAGTTTGTGATGGCAGCATACATGCAATCCTACGCCCAA
AACTTCAACCTCGAGCCCTACATGCACTTCAACACCACCGTCACGCACGTCAAACGCAACCCTTCCAACACAGCA
TGGACCATCACCTTCACCCTCCCCTCCGGAACCCCCCAATCCCTCCACTTCGACAAGGTCGTCTTCAGCACCGGC
TCCGAAAGACTCCCCCTCTGGCCCTCCCTCCCCGGCCACCAGACCTTCACCGGCCAGATCCTCCACGGCCAGAGC
TACCGCTGCCCAGAGGCCTTTGCGGGGAGGCGCGTGCTGGTGGTTGGCATGGGGAACACCGCCTGCGATGTATCT
CTCAGTCTTACACGCCACGCCTCTCACGTCTACCAGTCCTACCGCCGCGGTCGAACCGTGCTGTCGCGATACCTG
GACAACGGCCTTCCCACCGATACGCTCATGACGTGGCCACTCCTCCGGCTGAAATACTTCCTAGACGCCAAGATC
CCATCCCTTTCGCGCCTCGTTGTCGATACGCTGGTCAAGCGCAAGATGGTCTCTGACGCAGCGCGCCAAGAAACA
TCCAAGTCCAAGGCCTCCGCGCGACGAAGATTGCAAACATGGCGACTCCTCGATGGACCGAGTCTCTCCCACACC
CATCCCGCTGTGCAGGAAGACTTCCTGTCCGCGCTGTACGATGAAAGCGTGGTGCCCGTGTCCGGCTTCCGGGCG
TTTGTGGGAGCGGATGCCGTCTTGCTCGAGGACGGGACCGTGATTCGTGCGGATGCCGTCATCTTCTGCACGGGA
TATTCCAACGGCTTCAGCATCATGCCTGAGCTGGAGATGGATGGAGCCTGCCGTCTCCCCCCCCAAACCGCCCTC
GACGCCGAAACCGACCAAAGCACATCTTCACAACCTCACCTCCCGCGCCTCTACCAGATGATGTTCCCCCCCAAA
CACGCCTCCTCAATCGCCTTCCTCAGCTGGATGGCCCCCCAGCAAAGCGTCTGGACCGTCGCAGAACTCGCCTCC
ACAGCCCTCTCCCAAATCTGGGCCTCCCAAACCACCCCCCCCACGCCCAACACCCGCCCTGCAACCCTCCCGCCC
GAGGCCAAGATGGAAGCCTGGGTAGACGGCTACCACAGCTGGTGGCGGTCCCAGCACGCGCGCGAGCCGTCGATG
CGCTCCGGCCTCCAATCGCAGCTCCCCTCCCTCCCCTCCAGCAGCCCCCTCCTCTTCGCCGCCAAAACAGCAAAG
AAGCTGACCTTCAGCCAACTCGCCACCCTCCTCCACCGCTCCGAAGTCGCCACCGCTGCCATCTTCTACGGCCAA
GCCCGCGCCTCGGAGGAGGACATTTCCGCCCTGGCCCACGCCCTCGACATCCCCCGCGCCCAGCTCGTCGAGGCC
CTCCCCGAATTCCCCGATCGCGGCCGCAGCGTCGAGATGCCGCCGAGGGATCCCCTCATCTATCGCTTGTTCGAG
GTGGTGCAGAACTATGGCTATGCTTACAAGGCGGTTTTGAATGAAAAGTTTGGCGATGGCATTATGAGTGGCGTT
TGCTTCTCTACTGATGTTCAGAAGGAGACGGACAAGGACGGTGCCGACTGGGCTGTCATTACCATGAAGGGTAAA
TGGTGCGTTCTCTCTTTCTACCGACCTGTTGACGGCGAGCCCTTGAAGCTGATGGTGGTCGTTGTCGAGGCTGCC
TTTTTCGAGGTTTTGATCCTGCTGCAACAGCCAGAATGGAGTGCCTACCTGACACATCGGTCATGA
Gene >Ophun1|1265
ATGGAAAAGATGAAAATCGCAATCATCGGTCTCGGTATGTCATCTTCCCTTCCCCCCTCTTTCCTCAGCACAAGG
CCGACTCACACACATGCCAGGCCCTGCCGGCTTGACAGCGCTGAAGTGCCTGCGGGAAGAGGGCTTCGACGCCGT
CGCGCTGGAGAGGCGGAGCGAGGTGGGCGGCGTGTGGTCGTACAGCGCCGACGGGAGTTACACGTCTGTGATTGG
GGAGACGGTCTCTAATATCAGCAAGTTTGTGGTGAGTTGTCTGCTGGGTGGGTGGGAGAGGATGCAGGGTTAATG
TGAGCAGTCTGGTTTCAGCGACTTTCCCATTCCAAAGGGTATGTGTCCCGTTTTTGAACATATCAAGATGCGATA
TATATATACATCTATGTGTATATGTGTGTGTACTGACGACGACAAGAATACCCTGCCTTTCTATCAGGCGCCCAG
ATGGCAGCATACATGCAATCCTACGCCCAAAACTTCAACCTCGAGCCCTACATGCACTTCAACACCACCGTCACG
CACGTCAAACGCAACCCTTCCAACACAGCATGGACCATCACCTTCACCCTCCCCTCCGGAACCCCCCAATCCCTC
CACTTCGACAAGGTCGTCTTCAGCACCGGCTCCGAAAGACTCCCCCTCTGGCCCTCCCTCCCCGGCCACCAGACC
TTCACCGGCCAGATCCTCCACGGCCAGAGCTACCGCTGCCCAGAGGCCTTTGCGGGGAGGCGCGTGCTGGTGGTT
GGCATGGGGAACACCGCCTGCGATGTATCTCTCAGTCTTACACGCCACGCCTCTCACGTCTACCAGTCCTACCGC
CGCGGTCGAACCGTGCTGTCGCGATACCTGGACAACGGCCTTCCCACCGATACGCTCATGACGTGGCCACTCCTC
CGGCTGAAATACTTCCTAGACGCCAAGATCCCATCCCTTTCGCGCCTCGTTGTCGATACGCTGGTCAAGCGCAAG
ATGGTCTCTGACGCAGCGCGCCAAGAAACATCCAAGTCCAAGGCCTCCGCGCGACGAAGATTGCAAACATGGCGA
CTCCTCGATGGACCGAGTCTCTCCCACACCCATCCCGCTGTGCAGGAAGACTTCCTGTCCGCGCTGTACGATGAA
AGCGTGGTGCCCGTGTCCGGCTTCCGGGCGTTTGTGGGAGCGGATGCCGTCTTGCTCGAGGACGGGACCGTGATT
CGTGCGGATGCCGTCATCTTCTGCACGGGATATTCCAACGGCTTCAGCATCATGCCTGAGCTGGAGATGGATGGA
GCCTGCCGTCTCCCCCCCCAAACCGCCCTCGACGCCGAAACCGACCAAAGCACATCTTCACAACCTCACCTCCCG
CGCCTCTACCAGATGATGTTCCCCCCCAAACACGCCTCCTCAATCGCCTTCCTCAGCTGGATGGCCCCCCAGCAA
AGCGTCTGGACCGTCGCAGAACTCGCCTCCACAGCCCTCTCCCAAATCTGGGCCTCCCAAACCACCCCCCCCACG
CCCAACACCCGCCCTGCAACCCTCCCGCCCGAGGCCAAGATGGAAGCCTGGGTAGACGGCTACCACAGCTGGTGG
CGGTCCCAGCACGCGCGCGAGCCGTCGATGCGCTCCGGCCTCGTCCGCCCGCATTCCTTCTACCGCTTTCTTCAC
CGCATGGCTGGCACGGGCATGTACCGTCGGGTCGGGTTGAGGCTGAGGCTGAGGGATGGGCGGTTGTATCGCTGT
GTGGCGGGAGGGCCGATGAATAGCTGTGCCTGGCGGCTGTTTGATACGAATCCAGCGCGGGTGCCGGGCTGTGGA
AGGGCAGCGTGGCCGGGCGCGAGACGAGCTCTGGAAGAAGCTGTGAGTTTACCCATATATATACATCTCAGAAGA
TTCCTCTGGCTAACCTGTTCAGTACGACGGCTACGAAGCCTACAAGTCCTCCTTGCTCAACACAAAACTCCCCCG
CCCAGCCAGCACCTCAACCCTCATCCGCCTCGACTCAGAGCCCGAAAAGAGAGTCTCAGACGATGGCTGGCCATG
GCGACCCGCCAGCCCGGACGAACCCATAGATCTACCTACTCACATATAGACAAGAGGTCCAGGTTCAGCCCCGAA
GCGTCAAAAGTGCCCCCGGCCGGTGACGTGCGTCCGATACAACGGATGGAACTATCGATGCACCTCGTCTCAACT
AGCCAGGATAGACACCCTGCTCTGATTGGTCGTGTCGTTGTAGAACAAGACTCCATCTCGGCCTCGGCTCGGCCT
CTCCTTCAGACATGGTAAACCCTACCTATCCGTACTTTGCAAGCCTACTTCCTCACCATCTCCAAAGCCCACCAA
AACAACAACTCCCCAAAATGACGCCCATCACAACCCTCGACGTCCGTCTATCCCCCCCCCAGAACCCTACTGCCA
CCACTAACAACAACCCAGCAATCGCAGCTCCCCTCCCTCCCCTCCAGCAGCCCCCTCCTCTTCGCCGCCAAAACA
GCAAAGAAGCTGACCTTCAGCCAACTCGCCACCCTCCTCCACCGCTCCGAAGTCGCCACCGCTGCCATCTTCTAC
GGCCAAGCCCGCGCCTCGGAGGAGGACATTTCCGCCCTGGCCCACGCCCTCGACATCCCCCGCGCCCAGCTCGTC
GAGGCCCTCCCCGAATTCCCCGATCGCGGCCGCAGCGTCGAGATGCCGCCGAGGGATCCCCTCATCTATCGCTTG
TTCGAGGTGGTGCAGAACTATGGCTATGCTTACAAGGCGGTTTTGAATGAAAAGTTTGGCGATGGCATTATGAGT
GGCGTTTGCTTCTCTACTGATGTTCAGAAGGAGACGGACAAGGACGGTGCCGACTGGGCTGTCATTACCATGAAG
GGTAAATGGTGCGTTCTCTCTTTCTACCGACCTGTTGACGGCGAGCCCTTGAAGCTGATGGTGGTCGTTGTCGAG
GCTGCCTTTTTCGAGGTTTTGATCCTGCTGCAACAGCCAGAATGGTATCTACAACTGTTGATCAATCATCATTGC
CTGCCCTCAAGTCCCGTGTTGTTGTAGGAGTGCCTACCTGACACATCGGTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail