Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1250
Gene name
LocationContig_1491:687..2127
Strand+
Gene length (bp)1440
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup527
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6551
Ophiocordyceps australis 1348a (Ghana) OphauG2|6552
Ophiocordyceps australis map64 (Brazil) OphauB2|1204
Ophiocordyceps camponoti-floridani Ophcf2|02797
Ophiocordyceps camponoti-rufipedis Ophun1|1250 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7284
Ophiocordyceps kimflemingae Ophio5|7111
Ophiocordyceps subramaniannii Hirsu2|3007

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1250
MTGAVTKCIVPGQDKNGLWHVYAGKQPRDFEGAHCDECATSGASGTCDADPLLGFACSECVKKMKKNGRKKCMVN
GKEMGARPNLRQGVEAWFRRQCDTCSNPKARKNQAGCSWLNNRDAWGTPCLQCQDRGFTCWDQGVIVGAIPETTA
PQEWTVSHQLGGSWAEVRPSTPWRKACRECVANGNHCRATADGAAFACNRCFQLGIDCVESGGEGEHYPLFDLSR
IGIGNFLPFHACDRCKEAGRNCDHQRPCDSCVDNGEQELCKDTPGEGNNKAPSCFAGRLHDKAGPLYYLALGYGA
GGVNDVKDGSQLEHWIGPPFPMYQMEGDNNGDGTEDHNRMAIVSLVQNQRRALKPEGIPPHGALEGNLGTKRPSE
LTAEELRQKLGENWPEIYPMNQHKEYQTVLQEAPTKRRAVVVEMTAARTRRRARGNTAAAPAAGAPAAAPVVPSN
GPPVQVLPQGQGQGQGGLMGAGGPQGGVD*
Coding >Ophun1|1250
ATGACGGGCGCCGTGACCAAGTGCATCGTCCCCGGACAGGACAAGAACGGCCTCTGGCACGTCTACGCTGGCAAG
CAGCCGCGGGACTTTGAGGGCGCGCACTGCGATGAGTGTGCGACTTCTGGGGCGTCGGGGACGTGTGATGCCGAT
CCGTTGCTGGGGTTTGCTTGCAGTGAATGCGTCAAGAAGATGAAGAAGAATGGGAGGAAGAAGTGCATGGTCAAC
GGCAAGGAGATGGGGGCACGACCGAATCTCAGACAGGGGGTTGAAGCCTGGTTCCGTCGTCAGTGCGATACCTGT
TCCAACCCCAAGGCTCGCAAGAACCAGGCTGGCTGCAGCTGGCTTAACAACCGCGACGCCTGGGGGACTCCGTGT
CTGCAGTGTCAGGACCGGGGCTTCACCTGCTGGGATCAGGGGGTCATCGTCGGGGCCATTCCCGAAACCACGGCG
CCTCAGGAATGGACCGTCTCGCACCAACTCGGCGGATCGTGGGCTGAGGTCCGGCCTTCGACGCCTTGGAGGAAG
GCTTGCCGCGAGTGTGTGGCCAACGGGAATCACTGCAGGGCCACGGCTGATGGAGCGGCTTTTGCTTGCAACCGG
TGCTTCCAGCTGGGCATCGACTGCGTGGAATCGGGCGGCGAGGGAGAGCATTATCCTCTCTTTGATCTCAGCCGC
ATCGGTATCGGCAACTTCCTCCCCTTTCACGCCTGTGATCGCTGCAAGGAAGCGGGCCGCAACTGCGATCACCAA
CGGCCCTGTGACTCGTGTGTCGACAACGGGGAACAGGAGCTGTGTAAAGACACGCCGGGAGAAGGGAACAACAAG
GCGCCCAGCTGCTTCGCCGGAAGGCTGCATGACAAGGCTGGACCGCTGTATTACCTCGCTCTCGGGTACGGAGCC
GGAGGCGTCAACGATGTCAAGGACGGGTCGCAGCTGGAGCACTGGATTGGACCGCCGTTTCCCATGTATCAGATG
GAGGGCGACAACAACGGGGACGGAACCGAGGATCACAACAGGATGGCTATCGTCTCGCTGGTTCAGAACCAGAGA
CGGGCTCTCAAGCCGGAGGGGATCCCTCCTCACGGCGCACTGGAAGGCAACCTCGGCACCAAGAGACCCAGCGAG
TTGACGGCCGAAGAGCTCCGCCAGAAACTCGGAGAGAACTGGCCGGAGATTTACCCGATGAACCAGCACAAAGAG
TACCAGACGGTACTGCAAGAGGCTCCTACCAAGCGTCGAGCCGTCGTCGTCGAGATGACGGCGGCACGGACCAGG
AGGAGGGCTCGCGGGAACACGGCAGCGGCTCCTGCGGCGGGGGCTCCGGCTGCTGCTCCTGTGGTTCCGAGCAAC
GGGCCGCCGGTGCAGGTGCTTCCTCAGGGGCAGGGGCAGGGGCAGGGGGGGTTGATGGGGGCTGGGGGTCCGCAG
GGTGGTGTCGATTAA
Transcript >Ophun1|1250
ATGACGGGCGCCGTGACCAAGTGCATCGTCCCCGGACAGGACAAGAACGGCCTCTGGCACGTCTACGCTGGCAAG
CAGCCGCGGGACTTTGAGGGCGCGCACTGCGATGAGTGTGCGACTTCTGGGGCGTCGGGGACGTGTGATGCCGAT
CCGTTGCTGGGGTTTGCTTGCAGTGAATGCGTCAAGAAGATGAAGAAGAATGGGAGGAAGAAGTGCATGGTCAAC
GGCAAGGAGATGGGGGCACGACCGAATCTCAGACAGGGGGTTGAAGCCTGGTTCCGTCGTCAGTGCGATACCTGT
TCCAACCCCAAGGCTCGCAAGAACCAGGCTGGCTGCAGCTGGCTTAACAACCGCGACGCCTGGGGGACTCCGTGT
CTGCAGTGTCAGGACCGGGGCTTCACCTGCTGGGATCAGGGGGTCATCGTCGGGGCCATTCCCGAAACCACGGCG
CCTCAGGAATGGACCGTCTCGCACCAACTCGGCGGATCGTGGGCTGAGGTCCGGCCTTCGACGCCTTGGAGGAAG
GCTTGCCGCGAGTGTGTGGCCAACGGGAATCACTGCAGGGCCACGGCTGATGGAGCGGCTTTTGCTTGCAACCGG
TGCTTCCAGCTGGGCATCGACTGCGTGGAATCGGGCGGCGAGGGAGAGCATTATCCTCTCTTTGATCTCAGCCGC
ATCGGTATCGGCAACTTCCTCCCCTTTCACGCCTGTGATCGCTGCAAGGAAGCGGGCCGCAACTGCGATCACCAA
CGGCCCTGTGACTCGTGTGTCGACAACGGGGAACAGGAGCTGTGTAAAGACACGCCGGGAGAAGGGAACAACAAG
GCGCCCAGCTGCTTCGCCGGAAGGCTGCATGACAAGGCTGGACCGCTGTATTACCTCGCTCTCGGGTACGGAGCC
GGAGGCGTCAACGATGTCAAGGACGGGTCGCAGCTGGAGCACTGGATTGGACCGCCGTTTCCCATGTATCAGATG
GAGGGCGACAACAACGGGGACGGAACCGAGGATCACAACAGGATGGCTATCGTCTCGCTGGTTCAGAACCAGAGA
CGGGCTCTCAAGCCGGAGGGGATCCCTCCTCACGGCGCACTGGAAGGCAACCTCGGCACCAAGAGACCCAGCGAG
TTGACGGCCGAAGAGCTCCGCCAGAAACTCGGAGAGAACTGGCCGGAGATTTACCCGATGAACCAGCACAAAGAG
TACCAGACGGTACTGCAAGAGGCTCCTACCAAGCGTCGAGCCGTCGTCGTCGAGATGACGGCGGCACGGACCAGG
AGGAGGGCTCGCGGGAACACGGCAGCGGCTCCTGCGGCGGGGGCTCCGGCTGCTGCTCCTGTGGTTCCGAGCAAC
GGGCCGCCGGTGCAGGTGCTTCCTCAGGGGCAGGGGCAGGGGCAGGGGGGGTTGATGGGGGCTGGGGGTCCGCAG
GGTGGTGTCGATTAA
Gene >Ophun1|1250
ATGACGGGCGCCGTGACCAAGTGCATCGTCCCCGGACAGGACAAGAACGGCCTCTGGCACGTCTACGCTGGCAAG
CAGCCGCGGGACTTTGAGGGCGCGCACTGCGATGAGTGTGCGACTTCTGGGGCGTCGGGGACGTGTGATGCCGAT
CCGTTGCTGGGGTTTGCTTGCAGTGAATGCGTCAAGAAGATGAAGAAGAATGGGAGGAAGAAGTGCATGGTCAAC
GGCAAGGAGATGGGGGCACGACCGAATCTCAGACAGGGGGTTGAAGCCTGGTTCCGTCGTCAGTGCGATACCTGT
TCCAACCCCAAGGCTCGCAAGAACCAGGCTGGCTGCAGCTGGCTTAACAACCGCGACGCCTGGGGGACTCCGTGT
CTGCAGTGTCAGGACCGGGGCTTCACCTGCTGGGATCAGGGGGTCATCGTCGGGGCCATTCCCGAAACCACGGCG
CCTCAGGAATGGACCGTCTCGCACCAACTCGGCGGATCGTGGGCTGAGGTCCGGCCTTCGACGCCTTGGAGGAAG
GCTTGCCGCGAGTGTGTGGCCAACGGGAATCACTGCAGGGCCACGGCTGATGGAGCGGCTTTTGCTTGCAACCGG
TGCTTCCAGCTGGGCATCGACTGCGTGGAATCGGGCGGCGAGGGAGAGCATTATCCTCTCTTTGATCTCAGCCGC
ATCGGTATCGGCAACTTCCTCCCCTTTCACGCCTGTGATCGCTGCAAGGAAGCGGGCCGCAACTGCGATCACCAA
CGGCCCTGTGACTCGTGTGTCGACAACGGGGAACAGGAGCTGTGTAAAGACACGCCGGGAGAAGGGAACAACAAG
GCGCCCAGCTGCTTCGCCGGAAGGCTGCATGACAAGGCTGGACCGCTGTATTACCTCGCTCTCGGGTACGGAGCC
GGAGGCGTCAACGATGTCAAGGACGGGTCGCAGCTGGAGCACTGGATTGGACCGCCGTTTCCCATGTATCAGATG
GAGGGCGACAACAACGGGGACGGAACCGAGGATCACAACAGGATGGCTATCGTCTCGCTGGTTCAGAACCAGAGA
CGGGCTCTCAAGCCGGAGGGGATCCCTCCTCACGGCGCACTGGAAGGCAACCTCGGCACCAAGAGACCCAGCGAG
TTGACGGCCGAAGAGCTCCGCCAGAAACTCGGAGAGAACTGGCCGGAGATTTACCCGATGAACCAGCACAAAGAG
TACCAGACGGTACTGCAAGAGGCTCCTACCAAGCGTCGAGCCGTCGTCGTCGAGATGACGGCGGCACGGACCAGG
AGGAGGGCTCGCGGGAACACGGCAGCGGCTCCTGCGGCGGGGGCTCCGGCTGCTGCTCCTGTGGTTCCGAGCAAC
GGGCCGCCGGTGCAGGTGCTTCCTCAGGGGCAGGGGCAGGGGCAGGGGGGGTTGATGGGGGCTGGGGGTCCGCAG
GGTGGTGTCGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail