Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1246
Gene name
LocationContig_149:26503..27146
Strand-
Gene length (bp)643
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09747 CCD97-like_C Coiled-coil domain containing protein 97-like, C-terminal 3.8E-08 31 78
PF09747 CCD97-like_C Coiled-coil domain containing protein 97-like, C-terminal 7.9E-14 107 168

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4400
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|459
Ophiocordyceps australis map64 (Brazil) OphauB2|4822
Ophiocordyceps camponoti-floridani Ophcf2|03002
Ophiocordyceps camponoti-rufipedis Ophun1|1246 (this protein)
Ophiocordyceps kimflemingae Ophio5|4339
Ophiocordyceps subramaniannii Hirsu2|911

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1246
MDSRLTGPSFEKPTPLPPKTDAQKASIVVRNRRREYLERHPSYLDNPDHELADALLYERLITRFQTEQERDAQDL
AKGYDNVVQAHAARTQTSSSHAAHTWDVSLGAEDPHVVHVADRDHGRRLWRDFIRDRFLAGADDDFHYPPVDNDQ
DLDVQAARDAQDEWFDDEEPAWHSPDDVVGNGFRPGETGVQDF*
Coding >Ophun1|1246
ATGGACTCCCGCCTGACCGGCCCATCCTTCGAAAAGCCCACTCCCCTCCCTCCAAAGACGGACGCACAAAAGGCC
TCGATCGTCGTCAGAAACCGTCGACGCGAGTATCTAGAGCGCCACCCGTCCTACCTCGACAATCCCGACCACGAG
CTTGCCGATGCTCTCCTCTACGAACGCCTCATCACCCGCTTTCAGACGGAACAAGAGCGCGACGCCCAAGATCTA
GCCAAAGGCTACGACAACGTCGTTCAAGCCCACGCTGCCCGCACCCAGACCTCAAGCTCTCATGCCGCACACACC
TGGGACGTCTCGCTAGGCGCCGAAGACCCCCACGTCGTCCACGTCGCCGACAGGGACCACGGCCGTCGTCTCTGG
CGCGACTTCATCCGTGACCGCTTCCTCGCAGGCGCAGACGATGACTTCCACTACCCACCCGTCGACAACGACCAA
GACCTCGACGTCCAAGCTGCGAGGGATGCCCAAGACGAGTGGTTCGACGACGAGGAACCCGCCTGGCACAGCCCA
GACGATGTCGTCGGCAACGGCTTTCGTCCAGGCGAGACGGGCGTCCAGGACTTTTAA
Transcript >Ophun1|1246
ATGGACTCCCGCCTGACCGGCCCATCCTTCGAAAAGCCCACTCCCCTCCCTCCAAAGACGGACGCACAAAAGGCC
TCGATCGTCGTCAGAAACCGTCGACGCGAGTATCTAGAGCGCCACCCGTCCTACCTCGACAATCCCGACCACGAG
CTTGCCGATGCTCTCCTCTACGAACGCCTCATCACCCGCTTTCAGACGGAACAAGAGCGCGACGCCCAAGATCTA
GCCAAAGGCTACGACAACGTCGTTCAAGCCCACGCTGCCCGCACCCAGACCTCAAGCTCTCATGCCGCACACACC
TGGGACGTCTCGCTAGGCGCCGAAGACCCCCACGTCGTCCACGTCGCCGACAGGGACCACGGCCGTCGTCTCTGG
CGCGACTTCATCCGTGACCGCTTCCTCGCAGGCGCAGACGATGACTTCCACTACCCACCCGTCGACAACGACCAA
GACCTCGACGTCCAAGCTGCGAGGGATGCCCAAGACGAGTGGTTCGACGACGAGGAACCCGCCTGGCACAGCCCA
GACGATGTCGTCGGCAACGGCTTTCGTCCAGGCGAGACGGGCGTCCAGGACTTTTAA
Gene >Ophun1|1246
ATGGACTCCCGCCTGACCGGCCCATCCTTCGAAAAGCCCACTCCCCTCCCTCCAAAGACGGACGCACAAAAGGCC
TCGATCGTCGTCAGAAACCGTCGACGCGAGTATCTAGAGCGCCACCCGTCCTACCTCGACAATCCCGACCACGAG
CTTGCCGGTAAGCAATCAGCGCTTAGGTAGTAGCTCTCCTTTTACAATCTCTTGAACTTATCTCGCAGATGCTCT
CCTCTACGAACGCCTCATCACCCGCTTTCAGACGGAACAAGAGCGCGACGCCCAAGATCTAGCCAAAGGCTACGA
CAACGTCGTTCAAGCCCACGCTGCCCGCACCCAGACCTCAAGCTCTCATGCCGCACACACCTGGGACGTCTCGCT
AGGCGCCGAAGACCCCCACGTCGTCCACGTCGCCGACAGGGACCACGGCCGTCGTCTCTGGCGCGACTTCATCCG
TGACCGCTTCCTCGCAGGCGCAGACGATGACTTCCACTACCCACCCGTCGACAACGACCAAGACCTCGACGTCCA
AGCTGCGAGGGATGCCCAAGACGAGTGGTTCGACGACGAGGAACCCGCCTGGCACAGCCCAGACGATGTCGTCGG
CAACGGCTTTCGTCCAGGCGAGACGGGCGTCCAGGACTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail