Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|124
Gene name
LocationContig_101:8189..9184
Strand+
Gene length (bp)995
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 5.6E-27 37 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06178|NMA1_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA1 PE=1 SV=1 16 260 1.0E-84
sp|P53204|NMA2_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA2 PE=1 SV=1 16 266 2.0E-84
sp|Q9UT53|NMAH_SCHPO Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.06c PE=1 SV=2 16 255 2.0E-84
sp|Q0DWH7|NMNAT_ORYSJ Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Oryza sativa subsp. japonica GN=Os02g0814900 PE=3 SV=2 31 255 1.0E-50
sp|Q0VD50|NMNA1_BOVIN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Bos taurus GN=NMNAT1 PE=2 SV=1 31 247 2.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06178|NMA1_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA1 PE=1 SV=1 16 260 1.0E-84
sp|P53204|NMA2_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA2 PE=1 SV=1 16 266 2.0E-84
sp|Q9UT53|NMAH_SCHPO Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.06c PE=1 SV=2 16 255 2.0E-84
sp|Q0DWH7|NMNAT_ORYSJ Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Oryza sativa subsp. japonica GN=Os02g0814900 PE=3 SV=2 31 255 1.0E-50
sp|Q0VD50|NMNA1_BOVIN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Bos taurus GN=NMNAT1 PE=2 SV=1 31 247 2.0E-47
sp|Q9HAN9|NMNA1_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Homo sapiens GN=NMNAT1 PE=1 SV=1 31 247 2.0E-47
sp|Q99JR6|NMNA3_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 OS=Mus musculus GN=Nmnat3 PE=1 SV=1 31 250 2.0E-47
sp|F4K687|NMNAT_ARATH Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Arabidopsis thaliana GN=NMNAT PE=2 SV=1 31 254 3.0E-47
sp|Q9EPA7|NMNA1_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Mus musculus GN=Nmnat1 PE=1 SV=2 29 247 5.0E-47
sp|Q96T66|NMNA3_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 OS=Homo sapiens GN=NMNAT3 PE=1 SV=2 31 247 4.0E-46
sp|P91851|NMNA2_CAEEL Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Caenorhabditis elegans GN=nmat-2 PE=3 SV=1 34 247 2.0E-25
sp|A4IH61|NMNA2_XENTR Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Xenopus tropicalis GN=nmnat2 PE=2 SV=1 28 181 4.0E-24
sp|Q9BZQ4|NMNA2_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Homo sapiens GN=NMNAT2 PE=1 SV=1 28 181 5.0E-24
sp|Q5RBL5|NMNA2_PONAB Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Pongo abelii GN=NMNAT2 PE=2 SV=1 28 181 7.0E-24
sp|Q8BNJ3|NMNA2_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Mus musculus GN=Nmnat2 PE=2 SV=1 28 181 9.0E-24
sp|Q0HA29|NMNA2_RAT Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Rattus norvegicus GN=Nmnat2 PE=2 SV=1 28 181 1.0E-23
sp|Q0VC59|NMNA2_BOVIN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Bos taurus GN=NMNAT2 PE=2 SV=1 28 138 2.0E-23
sp|Q6PC93|NMNA2_DANRE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Danio rerio GN=nmnat2 PE=2 SV=1 28 138 2.0E-22
sp|Q5RBL5|NMNA2_PONAB Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Pongo abelii GN=NMNAT2 PE=2 SV=1 149 244 5.0E-08
sp|Q8BNJ3|NMNA2_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Mus musculus GN=Nmnat2 PE=2 SV=1 149 244 5.0E-08
sp|Q0VC59|NMNA2_BOVIN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Bos taurus GN=NMNAT2 PE=2 SV=1 149 244 5.0E-08
sp|Q9BZQ4|NMNA2_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Homo sapiens GN=NMNAT2 PE=1 SV=1 149 244 6.0E-08
sp|Q0HA29|NMNA2_RAT Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Rattus norvegicus GN=Nmnat2 PE=2 SV=1 149 244 6.0E-08
sp|Q6PC93|NMNA2_DANRE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Danio rerio GN=nmnat2 PE=2 SV=1 149 244 2.0E-07
sp|A4IH61|NMNA2_XENTR Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Xenopus tropicalis GN=nmnat2 PE=2 SV=1 149 244 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup387
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7550
Ophiocordyceps australis map64 (Brazil) OphauB2|5021
Ophiocordyceps australis map64 (Brazil) OphauB2|5327
Ophiocordyceps camponoti-floridani Ophcf2|01525
Ophiocordyceps camponoti-rufipedis Ophun1|124 (this protein)
Ophiocordyceps kimflemingae Ophio5|7621
Ophiocordyceps subramaniannii Hirsu2|1512
Ophiocordyceps subramaniannii Hirsu2|7438

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|124
MASDFEYVKRMTPPGYVFPSARLQRTCEAGRTPLVLVACGSFSPITFLHLRMFPMARDHCRNEGFEVIGGYFSLV
SDAYKKKGLAPACHRLRMCELAAENTSNWLMVDPWEAEHTTYIPTARVLDHFEYEINHVMGGVECSDGTRKRAKI
VLLAGADLIQTISNPDVWDARDVDHILGDFGVFVLERTGTELDSALASLKQWEKNIHVIRQVVTNDISSTKVRLL
LKRDMSIDYLIPAEVIRYIDEHPYIYRDLDLPVDKNKDKDEAPTKMRASNG*
Coding >Ophun1|124
ATGGCATCCGACTTCGAATACGTCAAGCGAATGACGCCTCCAGGCTACGTCTTCCCCTCCGCTCGTCTACAGCGC
ACCTGCGAGGCCGGTCGAACGCCCCTCGTCCTCGTCGCCTGTGGATCCTTCTCGCCCATCACCTTTCTACACCTC
CGCATGTTCCCCATGGCTCGAGACCACTGTCGGAACGAAGGCTTCGAAGTCATCGGCGGTTACTTCTCCCTCGTG
TCCGACGCCTACAAGAAGAAGGGGCTCGCGCCCGCCTGTCACCGCCTGCGAATGTGCGAGCTGGCCGCCGAGAAC
ACGTCCAACTGGCTCATGGTCGACCCCTGGGAAGCCGAGCACACGACCTATATCCCTACCGCCCGAGTCCTCGAC
CACTTCGAGTACGAGATTAACCACGTCATGGGCGGCGTCGAGTGCTCCGACGGCACCCGCAAACGCGCCAAGATT
GTCCTCCTAGCCGGCGCCGATCTGATTCAGACGATTAGCAATCCCGACGTCTGGGATGCCCGCGACGTCGACCAT
ATTCTCGGCGACTTTGGCGTCTTTGTTCTCGAGCGTACCGGAACCGAGCTCGACTCTGCACTGGCCAGCCTAAAG
CAGTGGGAGAAGAATATCCACGTCATCCGTCAGGTGGTGACGAATGACATTAGTAGCACCAAGGTGCGGCTGTTG
CTAAAGCGAGACATGAGCATCGACTATCTCATACCAGCCGAAGTGATTCGCTACATCGACGAGCACCCCTACATC
TATCGCGATCTAGATCTACCCGTCGACAAGAACAAAGACAAGGACGAGGCGCCTACCAAGATGCGGGCCAGCAAC
GGCTGA
Transcript >Ophun1|124
ATGGCATCCGACTTCGAATACGTCAAGCGAATGACGCCTCCAGGCTACGTCTTCCCCTCCGCTCGTCTACAGCGC
ACCTGCGAGGCCGGTCGAACGCCCCTCGTCCTCGTCGCCTGTGGATCCTTCTCGCCCATCACCTTTCTACACCTC
CGCATGTTCCCCATGGCTCGAGACCACTGTCGGAACGAAGGCTTCGAAGTCATCGGCGGTTACTTCTCCCTCGTG
TCCGACGCCTACAAGAAGAAGGGGCTCGCGCCCGCCTGTCACCGCCTGCGAATGTGCGAGCTGGCCGCCGAGAAC
ACGTCCAACTGGCTCATGGTCGACCCCTGGGAAGCCGAGCACACGACCTATATCCCTACCGCCCGAGTCCTCGAC
CACTTCGAGTACGAGATTAACCACGTCATGGGCGGCGTCGAGTGCTCCGACGGCACCCGCAAACGCGCCAAGATT
GTCCTCCTAGCCGGCGCCGATCTGATTCAGACGATTAGCAATCCCGACGTCTGGGATGCCCGCGACGTCGACCAT
ATTCTCGGCGACTTTGGCGTCTTTGTTCTCGAGCGTACCGGAACCGAGCTCGACTCTGCACTGGCCAGCCTAAAG
CAGTGGGAGAAGAATATCCACGTCATCCGTCAGGTGGTGACGAATGACATTAGTAGCACCAAGGTGCGGCTGTTG
CTAAAGCGAGACATGAGCATCGACTATCTCATACCAGCCGAAGTGATTCGCTACATCGACGAGCACCCCTACATC
TATCGCGATCTAGATCTACCCGTCGACAAGAACAAAGACAAGGACGAGGCGCCTACCAAGATGCGGGCCAGCAAC
GGCTGA
Gene >Ophun1|124
ATGGCATCCGACTTCGAATACGTCAAGCGAATGACGCCTCCAGGCTACGTCTTCCCCTCCGCTCGTCTACAGCGC
ACCTGCGAGGCCGGTCGAACGCCCCTCGTCCTCGTCGCCTGTGGATCCTGTGAGTCGCAGCGAGCCCTCATTCCC
ACCAGACCAGACTTGCGCTGACCATTCATGGCCAGTCTCGCCCATCACCTTTCTACACCTCCGCATGTTCCCCAT
GGCTCGAGACCACTGTCGGAACGAAGGCTTCGAAGTCATCGGCGGTTACTTCTCCCTCGTGTCCGACGCCTACAA
GAAGAAGGGGCTCGCGCCCGCCTGTCACCGCCTGCGAATGTGCGAGCTGGCCGCCGAGAACACGTCCAACTGGCT
CATGGTCGACCCCTGGGAAGCCGAGCACACGACCTATATCCCTACCGCCCGAGTCCTCGACCACTTCGAGTACGA
GATTAACCACGTCATGGGCGGCGTCGAGTGCTCCGACGGCACCCGCAAACGCGCCAAGATTGTCCTCCTAGCCGG
CGCCGATCTGATTCAGACGATTAGCAATCCCGACGTCTGGGATGCCCGCGACGTCGACCATATTCTCGGCGACTT
TGGCGTCTTTGTTCTCGAGCGTACCGGAACCGAGCTCGACTCTGCACTGGCCAGCCTAAAGCAGTGGGAGAAGAA
TATCCACGTCATCCGTCAGGTAAGAGGCATCGCAACTCGATGGAATGAAGGATGCTCACTCCCGCTTAGGTGGTG
ACGAATGACATTAGTAGCACCAAGGTGCGGCTGTTGCTAAAGCGAGACATGAGCATCGACTATCTGTGAGCAGCC
GACATGTTCTACATGAAGTCATCAGCAACTAACCCGCGTGCAGCATACCAGCCGAAGTGATTCGCTACATCGACG
AGCACCCCTACATCTATCGCGATCTAGATCTACCCGTCGACAAGAACAAAGACAAGGACGAGGCGCCTACCAAGA
TGCGGGCCAGCAACGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail