Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1236
Gene name
LocationContig_149:185..491
Strand+
Gene length (bp)306
Transcript length (bp)252
Coding sequence length (bp)252
Protein length (aa) 84

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.999744

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup315
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03012
Ophiocordyceps camponoti-rufipedis Ophun1|1236 (this protein)
Ophiocordyceps kimflemingae Ophio5|4696
Ophiocordyceps kimflemingae Ophio5|500
Ophiocordyceps subramaniannii Hirsu2|1762
Ophiocordyceps subramaniannii Hirsu2|3584
Ophiocordyceps subramaniannii Hirsu2|8094

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1236
MKFLAIVALAAVATAAPTDVEPRSSVNKCNLNTQQKVCCNGLLGCVVQLLGSSCADRAYCCETGAATGGLVNING
LNCVNLSN*
Coding >Ophun1|1236
ATGAAGTTCCTCGCCATCGTCGCCCTGGCCGCCGTCGCCACCGCCGCTCCCACAGACGTTGAGCCCCGTTCCAGC
GTCAACAAGTGCAACCTCAACACGCAGCAGAAGGTGTGCTGCAACGGCCTCCTCGGCTGCGTCGTCCAGCTCCTC
GGCTCCAGCTGCGCCGACCGCGCCTACTGCTGCGAGACCGGTGCTGCCACCGGCGGTCTTGTCAACATCAACGGC
CTCAACTGCGTCAACCTCTCGAATTAG
Transcript >Ophun1|1236
ATGAAGTTCCTCGCCATCGTCGCCCTGGCCGCCGTCGCCACCGCCGCTCCCACAGACGTTGAGCCCCGTTCCAGC
GTCAACAAGTGCAACCTCAACACGCAGCAGAAGGTGTGCTGCAACGGCCTCCTCGGCTGCGTCGTCCAGCTCCTC
GGCTCCAGCTGCGCCGACCGCGCCTACTGCTGCGAGACCGGTGCTGCCACCGGCGGTCTTGTCAACATCAACGGC
CTCAACTGCGTCAACCTCTCGAATTAG
Gene >Ophun1|1236
ATGAAGTTCCTCGCCATCGTCGCCCTGGCCGCCGTCGCCACCGCCGCTCCCACAGACGTTGAGCCCCGTTCCAGC
GTCAACAAGTGCAACCTCAACACGCAGCAGAAGGTGTGCTGCAACGGCCTCCTCGGCTGCGTCGTCCAGCTCCTC
GGCTCCAGCTGCGCCGACCGCGCCTACTGCTGCGAGACCGGTGCTGCCACCGTGAGTATCCTTGTTTCAGAATGA
CCGGTACGAGTATACGCTAACTGTTGGCAGGGCGGTCTTGTCAACATCAACGGCCTCAACTGCGTCAACCTCTCG
AATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail