Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1233
Gene name
LocationContig_1484:442..1298
Strand-
Gene length (bp)856
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11927 DUF3445 Protein of unknown function (DUF3445) 7.6E-45 114 267

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 2 24 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6000
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03098
Ophiocordyceps camponoti-rufipedis Ophun1|1233 (this protein)
Ophiocordyceps kimflemingae Ophio5|5157
Ophiocordyceps subramaniannii Hirsu2|10670

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1233
MMAFIFPAIALAVFGATLFLRPLLRKSGYLTTCSHSKDAPILGLEDDYRLADASVRLRSGFTVGQVRALGAFPDY
AKLSGVPLPSPVSASFRIEDAAPRPFRPLRWPYHQTMALQKLDPDYWLELESTYRSRIRQRQDLHAQHGSNILNS
LPGSELAQRELMEMAVQFLCARYPQYFELRGQTLVNHLLATEHHLDEVAPLRVLLDNVPEDFAVLLRDEGTGRYV
LRAGVVCSTIGWHVGEKMGMGLSEIHKAVPDFEEKLSLSVDR*
Coding >Ophun1|1233
ATGATGGCTTTCATCTTCCCAGCTATAGCCCTCGCCGTCTTCGGAGCAACCCTCTTTCTTCGACCGCTCCTCCGG
AAGTCGGGTTACCTCACGACATGCTCGCACAGCAAGGACGCACCCATCCTCGGCCTGGAAGACGACTACCGCCTC
GCCGATGCTTCGGTCCGGCTTCGTAGCGGCTTCACTGTCGGTCAGGTCCGGGCTCTGGGCGCGTTCCCCGATTAC
GCGAAGCTGTCTGGCGTGCCGCTCCCGTCACCCGTGTCCGCCTCATTCCGGATTGAAGACGCGGCGCCTCGGCCG
TTCAGACCGCTCCGATGGCCCTATCATCAGACAATGGCCCTCCAGAAGCTCGATCCGGATTACTGGCTCGAGCTG
GAAAGCACATACCGCTCTCGCATCCGCCAACGTCAAGACCTGCATGCCCAGCACGGAAGCAATATCCTCAACAGC
CTGCCAGGCTCTGAGCTGGCGCAAAGGGAACTGATGGAGATGGCGGTGCAGTTTCTGTGCGCGCGATACCCGCAG
TACTTTGAGCTGCGAGGTCAGACGCTGGTGAACCATCTTCTCGCAACGGAGCATCATCTCGACGAGGTGGCGCCG
CTTAGGGTCCTGCTGGATAACGTGCCCGAGGACTTTGCTGTTCTGTTGAGGGATGAGGGGACGGGGCGGTATGTG
TTGAGGGCGGGAGTGGTTTGCTCGACGATTGGGTGGCATGTTGGGGAGAAGATGGGGATGGGGCTTTCGGAGATT
CATAAGGCGGTGCCGGATTTTGAAGAGAAGCTGAGTCTGAGCGTTGATCGGTGA
Transcript >Ophun1|1233
ATGATGGCTTTCATCTTCCCAGCTATAGCCCTCGCCGTCTTCGGAGCAACCCTCTTTCTTCGACCGCTCCTCCGG
AAGTCGGGTTACCTCACGACATGCTCGCACAGCAAGGACGCACCCATCCTCGGCCTGGAAGACGACTACCGCCTC
GCCGATGCTTCGGTCCGGCTTCGTAGCGGCTTCACTGTCGGTCAGGTCCGGGCTCTGGGCGCGTTCCCCGATTAC
GCGAAGCTGTCTGGCGTGCCGCTCCCGTCACCCGTGTCCGCCTCATTCCGGATTGAAGACGCGGCGCCTCGGCCG
TTCAGACCGCTCCGATGGCCCTATCATCAGACAATGGCCCTCCAGAAGCTCGATCCGGATTACTGGCTCGAGCTG
GAAAGCACATACCGCTCTCGCATCCGCCAACGTCAAGACCTGCATGCCCAGCACGGAAGCAATATCCTCAACAGC
CTGCCAGGCTCTGAGCTGGCGCAAAGGGAACTGATGGAGATGGCGGTGCAGTTTCTGTGCGCGCGATACCCGCAG
TACTTTGAGCTGCGAGGTCAGACGCTGGTGAACCATCTTCTCGCAACGGAGCATCATCTCGACGAGGTGGCGCCG
CTTAGGGTCCTGCTGGATAACGTGCCCGAGGACTTTGCTGTTCTGTTGAGGGATGAGGGGACGGGGCGGTATGTG
TTGAGGGCGGGAGTGGTTTGCTCGACGATTGGGTGGCATGTTGGGGAGAAGATGGGGATGGGGCTTTCGGAGATT
CATAAGGCGGTGCCGGATTTTGAAGAGAAGCTGAGTCTGAGCGTTGATCGGTGA
Gene >Ophun1|1233
ATGATGGCTTTCATCTTCCCAGCTATAGCCCTCGCCGTCTTCGGAGCAACCCTCTTTCTTCGACCGCTCCTCCGG
AAGTCGGGTTACCTCACGACATGCTCGCACAGCAAGGACGCACCCATCCTCGGCCTGGAAGACGACTACCGCCTC
GCCGATGCTTCGGTCCGGCTTCGTAGCGGCTTCACTGTCGGTCAGGTCCGGGCTCTGGGCGCGTTCCCCGATTAC
GCGAAGCTGTCTGGCGTGCCGCTCCCGTCACCCGTGTCCGCCTCATTCCGGATTGAAGACGCGGCGCCTCGGCCG
TTCAGACCGCTCCGATGGCCCTATCATCAGACAATGGGTACGATCTTCAAGACCTTCATGTCTCGTCAATCGTCG
TTAACGAGTTGAAGCCCTCCAGAAGCTCGATCCGGATTACTGGCTCGAGCTGGAAAGCACATACCGCTCTCGCAT
CCGCCAACGTCAAGACCTGCATGCCCAGCACGGAAGCAATATCCTCAACAGCCTGCCAGGCTCTGAGCTGGCGCA
AAGGGAACTGATGGAGATGGCGGTGCAGTTTCTGTGCGCGCGATACCCGCAGTACTTTGAGCTGCGAGGTCAGAC
GCTGGTGAACCATCTTCTCGCAACGGAGCATCATCTCGACGAGGTGGCGCCGCTTAGGGTCCTGCTGGATAACGT
GCCCGAGGACTTTGCTGTTCTGTTGAGGGATGAGGGGACGGGGCGGTATGTGTTGAGGGCGGGAGTGGTTTGCTC
GACGATTGGGTGGCATGTTGGGGAGAAGATGGGGATGGGGCTTTCGGAGATTCATAAGGCGGTGCCGGATTTTGA
AGAGAAGCTGAGTCTGAGCGTTGATCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail