Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1232
Gene name
LocationContig_1480:28..1871
Strand-
Gene length (bp)1843
Transcript length (bp)1422
Coding sequence length (bp)1422
Protein length (aa) 474

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 80 99 19
3 112 134 22
4 157 179 22
5 192 211 19
6 231 253 22
7 273 295 22
8 315 337 22
9 358 375 17
10 380 402 22
11 414 436 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1232
MVFDEAVESLGGSMCEKLLVGDTKHRRLTIEKMGKPSVVASDAVIYTTFAVFLLVGTAVAWRVRGSAAGELLSSN
GRKTAFPLALNLMASALGAGILFAYPEMATVTGLQGLIIYAVASALPLLLLGFVVGPAIRRRCPSGFVLTQWTEE
RYGREAMVYLSLVTLATLFLYMVAELSAMGHVVEALTGTGKGVLLIALLLVSGISVGVSSEALKPSLLSSAGLLS
PSLLGWQLLYILPVAITTNAFFLSSFWLRIFASRTDADLRLGSTLAAFVVACVLAAVGATGLVAVGTGAWPESPE
DKGSRALFALLERLPAAVVCLVLVMVVCLSTAMLDSLQSAMVSSASNDIFGNRLAPRYVRGLVIVVIVPVIIVAL
KGVSVLQIYLISDLLSAATIPILCLGLLDKMHWLRGTDVIAGGLGGLFSVFVFGWLYLGSAAEGGKLLILEDLYS
KDWRTFGAFAAAPLGEGGRWMGC*
Coding >Ophun1|1232
ATGGTGTTTGATGAAGCTGTGGAGTCGTTGGGCGGGTCTATGTGCGAGAAGCTGCTAGTGGGCGACACGAAACAT
CGCAGGCTGACAATTGAGAAGATGGGCAAGCCGTCGGTTGTTGCGTCGGACGCGGTCATCTACACGACATTTGCC
GTCTTTCTGCTGGTTGGGACGGCGGTTGCGTGGCGGGTTCGGGGGTCCGCAGCCGGAGAGCTACTGTCGAGCAAT
GGAAGAAAGACGGCCTTTCCGCTGGCCCTCAACCTGATGGCCTCAGCGCTGGGAGCGGGCATCCTGTTCGCGTAC
CCGGAGATGGCGACGGTAACGGGACTCCAGGGGTTAATCATTTACGCGGTGGCGTCGGCGCTCCCTCTGCTGTTG
CTGGGCTTCGTCGTCGGGCCGGCTATCCGTCGGCGGTGTCCGTCTGGCTTCGTGCTGACGCAGTGGACGGAGGAG
CGGTACGGGCGCGAGGCTATGGTTTACCTCAGTCTTGTTACGCTGGCGACGCTTTTCCTGTACATGGTTGCTGAG
CTTTCGGCTATGGGGCATGTTGTTGAGGCTTTGACGGGGACGGGCAAGGGCGTCCTCCTGATCGCTCTCCTGCTG
GTATCAGGCATCAGCGTCGGCGTCAGTTCCGAAGCCCTCAAGCCATCGCTGCTGTCCTCAGCAGGCCTCCTCTCT
CCGTCGCTGCTGGGCTGGCAACTCCTCTACATCCTACCCGTGGCGATAACGACAAACGCCTTCTTCCTGTCCAGC
TTCTGGCTGCGCATCTTCGCGTCACGGACGGATGCCGACCTTCGTCTTGGCTCTACGCTGGCGGCTTTCGTCGTG
GCCTGTGTGCTTGCTGCTGTTGGGGCCACGGGTCTCGTTGCGGTTGGGACGGGGGCTTGGCCTGAGAGTCCGGAG
GATAAGGGGTCTAGGGCTTTGTTTGCTTTGCTGGAGAGGTTGCCTGCTGCTGTTGTCTGTCTTGTTCTCGTCATG
GTGGTTTGCCTGAGCACGGCGATGCTGGATAGCCTTCAGTCTGCCATGGTGTCGTCTGCTTCCAACGACATCTTC
GGCAACAGGTTGGCGCCGCGGTACGTACGAGGCCTCGTCATCGTCGTCATCGTCCCCGTCATCATCGTCGCGCTC
AAGGGCGTTTCCGTTCTGCAGATTTACCTCATCAGCGACTTGCTCTCCGCCGCCACCATCCCAATCTTGTGTCTG
GGGCTGTTGGACAAGATGCACTGGTTACGGGGAACCGACGTCATCGCCGGCGGACTCGGCGGACTCTTCTCCGTC
TTCGTCTTCGGCTGGCTTTATCTGGGGAGCGCGGCTGAGGGGGGCAAGCTGTTGATCTTGGAGGACTTGTACAGC
AAGGACTGGAGGACGTTTGGGGCGTTTGCTGCTGCGCCGCTTGGAGAAGGGGGACGGTGGATGGGGTGTTGA
Transcript >Ophun1|1232
ATGGTGTTTGATGAAGCTGTGGAGTCGTTGGGCGGGTCTATGTGCGAGAAGCTGCTAGTGGGCGACACGAAACAT
CGCAGGCTGACAATTGAGAAGATGGGCAAGCCGTCGGTTGTTGCGTCGGACGCGGTCATCTACACGACATTTGCC
GTCTTTCTGCTGGTTGGGACGGCGGTTGCGTGGCGGGTTCGGGGGTCCGCAGCCGGAGAGCTACTGTCGAGCAAT
GGAAGAAAGACGGCCTTTCCGCTGGCCCTCAACCTGATGGCCTCAGCGCTGGGAGCGGGCATCCTGTTCGCGTAC
CCGGAGATGGCGACGGTAACGGGACTCCAGGGGTTAATCATTTACGCGGTGGCGTCGGCGCTCCCTCTGCTGTTG
CTGGGCTTCGTCGTCGGGCCGGCTATCCGTCGGCGGTGTCCGTCTGGCTTCGTGCTGACGCAGTGGACGGAGGAG
CGGTACGGGCGCGAGGCTATGGTTTACCTCAGTCTTGTTACGCTGGCGACGCTTTTCCTGTACATGGTTGCTGAG
CTTTCGGCTATGGGGCATGTTGTTGAGGCTTTGACGGGGACGGGCAAGGGCGTCCTCCTGATCGCTCTCCTGCTG
GTATCAGGCATCAGCGTCGGCGTCAGTTCCGAAGCCCTCAAGCCATCGCTGCTGTCCTCAGCAGGCCTCCTCTCT
CCGTCGCTGCTGGGCTGGCAACTCCTCTACATCCTACCCGTGGCGATAACGACAAACGCCTTCTTCCTGTCCAGC
TTCTGGCTGCGCATCTTCGCGTCACGGACGGATGCCGACCTTCGTCTTGGCTCTACGCTGGCGGCTTTCGTCGTG
GCCTGTGTGCTTGCTGCTGTTGGGGCCACGGGTCTCGTTGCGGTTGGGACGGGGGCTTGGCCTGAGAGTCCGGAG
GATAAGGGGTCTAGGGCTTTGTTTGCTTTGCTGGAGAGGTTGCCTGCTGCTGTTGTCTGTCTTGTTCTCGTCATG
GTGGTTTGCCTGAGCACGGCGATGCTGGATAGCCTTCAGTCTGCCATGGTGTCGTCTGCTTCCAACGACATCTTC
GGCAACAGGTTGGCGCCGCGGTACGTACGAGGCCTCGTCATCGTCGTCATCGTCCCCGTCATCATCGTCGCGCTC
AAGGGCGTTTCCGTTCTGCAGATTTACCTCATCAGCGACTTGCTCTCCGCCGCCACCATCCCAATCTTGTGTCTG
GGGCTGTTGGACAAGATGCACTGGTTACGGGGAACCGACGTCATCGCCGGCGGACTCGGCGGACTCTTCTCCGTC
TTCGTCTTCGGCTGGCTTTATCTGGGGAGCGCGGCTGAGGGGGGCAAGCTGTTGATCTTGGAGGACTTGTACAGC
AAGGACTGGAGGACGTTTGGGGCGTTTGCTGCTGCGCCGCTTGGAGAAGGGGGACGGTGGATGGGGTGTTGA
Gene >Ophun1|1232
ATGGTGTTTGATGAAGCTGTGGAGTCGTTGGGCGGGTCTATGTGCGAGAAGCTGCTAGTGGGCGACACGGTGCGA
TACGAGTTTTCCAGAGGGACGGGAATTATCGGGGTGTGAGATGGATGGGTGCTGAGCAGGTTTGTTGGCAGATTT
TGCATGCAGCGAGCACGTGGGACAGATGTTGACTGGCGCAGAAACATCGCAGGCTGACAATTGAGAAGATGGGCA
AGCCGTCGGTTGTTGCGTCGGACGCGGTCATCTACACGACATTTGCCGTCTTTCTGTGAGTTCTAGCTACAGTGC
GGGTTGATTGATGATGCTGAGGTCAACTGACAACTACATACAGGCTGGTTGGGACGGCGGTTGCGTGGCGGGTTC
GGGGGTCCGCAGCCGGAGAGCTACTGTCGAGCAATGGAAGAAAGACGGCCTTTCCGCTGGCCCTCAACCTGATGG
CCTCAGCGCTGGGAGCGGGCATCCTGTTCGCGTACCCGGAGATGGCGACGGTAACGGGACTCCAGGGGTTAATCA
TTTACGCGGTGGCGTCGGCGCTCCCTCTGCTGTTGCTGGGCTTCGTCGTCGGGCCGGCTATCCGTCGGCGGTGTC
CGTCTGGCTTCGTGCTGACGCAGTGGACGGAGGAGCGGTACGGGCGCGAGGCTATGGTTTACCTCAGTCTTGTTA
CGCTGGCGACGCTTTTCCTGTACATGGTTGCTGAGCTTTCGGCTATGGGGCATGTTGTTGAGGCTTTGACGGGGA
CGGGCAAGGTTGGGGTTTTGGTGGTTGAGTGTGTGGTTACCACGATTTATACGTGTGAGTTGTTCCTCTTGTTCC
ATTCATCTTGTTGTTGTTATTGCTGTTGCTGTCTTTGATGAATGATGGCTGATGATGCTGCTGGATGAAGCGCTG
GGTGGCTTCCGGGTTTCCTTCCTTACCGATGTCATCCAGGGCGTCCTCCTGATCGCTCTCCTGCTGGTATCAGGC
ATCAGCGTCGGCGTCAGTTCCGAAGCCCTCAAGCCATCGCTGCTGTCCTCAGCAGGCCTCCTCTCTCCGTCGCTG
CTGGGCTGGCAACTCCTCTACATCCTACCCGTGGCGATAACGACAAACGCCTTCTTCCTGTCCAGCTTCTGGCTG
CGCATCTTCGCGTCACGGACGGATGCCGACCTTCGTCTTGGCTCTACGCTGGCGGCTTTCGTCGTGGCCTGTGTG
CTTGCTGCTGTTGGGGCCACGGGTCTCGTTGCGGTTGGGACGGGGGCTTGGCCTGAGAGTCCGGAGGATAAGGGG
TCTAGGGCTTTGTTTGCTTTGCTGGAGAGGTTGCCTGCTGCTGTTGTCTGTCTTGTTCTCGTCATGGTGGTTTGC
CTGAGCACGGCGATGCTGGATAGCCTTCAGTCTGCCATGGTGTCGTCTGCTTCCAACGACATCTTCGGCAACAGG
TTGGCGCCGCGGTACGTACGAGGCCTCGTCATCGTCGTCATCGTCCCCGTCATCATCGTCGCGCTCAAGGGCGTT
TCCGTTCTGCAGATTTACCTCATCAGCGACTTGCTCTCCGCCGCCACCATCCCAATCTTGTGTCTGGGGCTGTTG
GACAAGATGCACTGGTTACGGGGAACCGACGTCATCGCCGGCGGACTCGGCGGACTCTTCTCCGTCTTCGTCTTC
GGCTGGCTTTATCTGGGGAGCGCGGCTGAGGGGGGCAAGCTGTTGATCTTGGAGGACTTGTACAGCAAGGACTGG
AGGACGTTTGGGGCGTTTGCTGCTGCGCCGTTTGGGGGGTTGCTGTTTGGCTTTGCGGCTGCGGGTTTGAGATTT
GGGGTTGAGGCTTGGAGAAGGGGGACGGTGGATGGGGTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail