Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1229
Gene name
LocationContig_148:26407..27928
Strand+
Gene length (bp)1521
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05148 Methyltransf_8 Hypothetical methyltransferase 1.6E-56 168 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38961|RRP8_YEAST 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP8 PE=1 SV=2 127 363 3.0E-56
sp|Q10257|RRP8_SCHPO 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp8 PE=3 SV=1 163 362 2.0E-51
sp|Q9DB85|RRP8_MOUSE Ribosomal RNA-processing protein 8 OS=Mus musculus GN=Rrp8 PE=1 SV=1 120 367 2.0E-44
sp|Q5U4F0|RRP8_RAT Ribosomal RNA-processing protein 8 OS=Rattus norvegicus GN=Rrp8 PE=1 SV=1 95 367 1.0E-43
sp|O43159|RRP8_HUMAN Ribosomal RNA-processing protein 8 OS=Homo sapiens GN=RRP8 PE=1 SV=2 168 367 3.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38961|RRP8_YEAST 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP8 PE=1 SV=2 127 363 3.0E-56
sp|Q10257|RRP8_SCHPO 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp8 PE=3 SV=1 163 362 2.0E-51
sp|Q9DB85|RRP8_MOUSE Ribosomal RNA-processing protein 8 OS=Mus musculus GN=Rrp8 PE=1 SV=1 120 367 2.0E-44
sp|Q5U4F0|RRP8_RAT Ribosomal RNA-processing protein 8 OS=Rattus norvegicus GN=Rrp8 PE=1 SV=1 95 367 1.0E-43
sp|O43159|RRP8_HUMAN Ribosomal RNA-processing protein 8 OS=Homo sapiens GN=RRP8 PE=1 SV=2 168 367 3.0E-43
sp|Q54CP1|RRP8_DICDI Ribosomal RNA-processing protein 8 OS=Dictyostelium discoideum GN=rrp8 PE=3 SV=1 164 374 2.0E-42
sp|Q84JC0|RRP8_ARATH Ribosomal RNA-processing protein 8 OS=Arabidopsis thaliana GN=At5g40530 PE=2 SV=1 120 452 3.0E-41
sp|A8XI07|RRP8_CAEBR Ribosomal RNA-processing protein 8 OS=Caenorhabditis briggsae GN=CBG13492 PE=3 SV=1 148 381 2.0E-34
sp|O44410|RRP8_CAEEL Ribosomal RNA-processing protein 8 OS=Caenorhabditis elegans GN=T07A9.8 PE=3 SV=1 170 373 5.0E-34
sp|Q7K2B0|RRP8_DROME Ribosomal RNA-processing protein 8 OS=Drosophila melanogaster GN=CG7137 PE=1 SV=1 138 366 4.0E-26
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1529
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6113
Ophiocordyceps australis map64 (Brazil) OphauB2|3548
Ophiocordyceps camponoti-floridani Ophcf2|04169
Ophiocordyceps camponoti-rufipedis Ophun1|1229 (this protein)
Ophiocordyceps kimflemingae Ophio5|6248
Ophiocordyceps subramaniannii Hirsu2|1122

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1229
MFAVPGWSVSADSLKAEKAPAGDVSETSRSKKRKRAGTSVTAANVVDLYETVFEGKKKKNKKGEKPSGDDGGAAK
VRTAQDSLKENKAAKSDKKKKAANPDVKGDAKSQLTRPKGDENSKKKNEAENQKKQKQQPKPESRDATESKPPAP
ASQPEPPKQPPAAKLTPLQASMKEKLVSARFRHLNETLYTRPSAEALRLFDESPDMFDDYHQGFRRQVKVWPENP
VDSFLQDIRARARAKTPAVTKARPGSTPAKRMGNPLPRTAGTCTIADLGCGDARLAESLEAEKLKLRLKLLSYDL
HSVSPLVTRADIAHLPLEDGSINVAIFCLALMGTNWIDFIEEAYRILHWKGELWVAEIKSRFGPVRNAHNPVSHS
VGNRKRPAAKAPRSSEKDGSDAEDLAVEVDGVEDRRHQTDVSAFVEVLRRRGFVLRGEANEAIDLSNRMFVKMHF
VKAAAPTKGKGAKAQEAAVKTTKGAVAKKWLGSGTGDNTEDADEAAILKPCVYKTR*
Coding >Ophun1|1229
ATGTTTGCTGTACCGGGCTGGTCCGTCTCCGCCGACAGCCTCAAGGCTGAGAAGGCCCCAGCCGGCGACGTGTCC
GAAACGTCCAGATCCAAGAAGCGCAAGAGAGCCGGAACTTCGGTCACGGCGGCCAACGTCGTTGATCTCTACGAG
ACAGTCTTTGAGGGCAAGAAGAAGAAGAATAAGAAGGGAGAGAAGCCTTCTGGCGACGATGGTGGCGCCGCTAAA
GTCCGGACCGCTCAAGATTCACTGAAAGAGAACAAGGCTGCAAAGTCGGACAAGAAGAAAAAGGCCGCCAATCCT
GATGTGAAAGGGGACGCTAAATCACAACTCACCCGACCTAAAGGCGACGAAAATTCGAAGAAGAAGAATGAAGCG
GAAAATCAGAAGAAGCAAAAGCAGCAGCCGAAGCCAGAGTCTCGAGATGCCACCGAGTCCAAACCACCGGCACCC
GCGTCACAACCCGAACCTCCAAAGCAACCCCCAGCCGCAAAACTCACGCCCCTGCAGGCATCTATGAAGGAAAAG
CTCGTGTCCGCCCGGTTCCGTCACCTCAACGAGACGCTCTACACCCGACCCTCGGCCGAAGCTCTGCGGCTCTTC
GACGAATCTCCCGACATGTTCGACGACTATCATCAGGGCTTCAGGCGGCAGGTCAAGGTCTGGCCTGAGAACCCC
GTCGACAGCTTCCTCCAGGATATCCGCGCCAGAGCTAGGGCGAAAACCCCCGCGGTCACCAAAGCTCGACCCGGC
AGCACCCCGGCCAAGCGGATGGGGAATCCGCTGCCGAGGACGGCTGGAACTTGCACCATCGCCGACCTCGGCTGC
GGAGACGCCCGTCTCGCTGAGTCTCTGGAGGCAGAAAAGCTCAAGCTTCGGCTCAAGCTTCTGAGCTACGACCTC
CACAGCGTCTCCCCCCTGGTCACCAGAGCCGACATCGCCCACCTGCCACTGGAAGACGGCTCCATCAACGTCGCC
ATCTTCTGCCTCGCACTCATGGGCACGAACTGGATCGACTTTATCGAGGAAGCCTATCGCATCCTCCACTGGAAA
GGCGAGCTCTGGGTCGCCGAGATCAAGAGTCGCTTCGGCCCCGTCCGCAACGCCCATAATCCAGTCTCCCACAGC
GTCGGCAACCGCAAGAGACCCGCCGCCAAGGCACCGCGCAGCTCCGAGAAAGACGGCTCCGACGCCGAGGATCTG
GCCGTCGAGGTCGACGGTGTCGAAGACCGCAGGCACCAGACGGACGTGTCAGCCTTTGTCGAGGTGCTCAGGCGC
AGGGGCTTCGTGCTCAGGGGAGAAGCCAACGAGGCCATCGACCTGTCGAACCGCATGTTCGTCAAGATGCACTTC
GTCAAGGCCGCTGCCCCCACGAAAGGGAAAGGCGCCAAGGCGCAGGAGGCTGCCGTCAAGACAACCAAAGGTGCC
GTCGCCAAGAAGTGGCTTGGGAGCGGCACAGGCGACAATACGGAGGACGCGGACGAGGCAGCCATACTCAAACCT
TGTGTCTACAAGACTCGCTGA
Transcript >Ophun1|1229
ATGTTTGCTGTACCGGGCTGGTCCGTCTCCGCCGACAGCCTCAAGGCTGAGAAGGCCCCAGCCGGCGACGTGTCC
GAAACGTCCAGATCCAAGAAGCGCAAGAGAGCCGGAACTTCGGTCACGGCGGCCAACGTCGTTGATCTCTACGAG
ACAGTCTTTGAGGGCAAGAAGAAGAAGAATAAGAAGGGAGAGAAGCCTTCTGGCGACGATGGTGGCGCCGCTAAA
GTCCGGACCGCTCAAGATTCACTGAAAGAGAACAAGGCTGCAAAGTCGGACAAGAAGAAAAAGGCCGCCAATCCT
GATGTGAAAGGGGACGCTAAATCACAACTCACCCGACCTAAAGGCGACGAAAATTCGAAGAAGAAGAATGAAGCG
GAAAATCAGAAGAAGCAAAAGCAGCAGCCGAAGCCAGAGTCTCGAGATGCCACCGAGTCCAAACCACCGGCACCC
GCGTCACAACCCGAACCTCCAAAGCAACCCCCAGCCGCAAAACTCACGCCCCTGCAGGCATCTATGAAGGAAAAG
CTCGTGTCCGCCCGGTTCCGTCACCTCAACGAGACGCTCTACACCCGACCCTCGGCCGAAGCTCTGCGGCTCTTC
GACGAATCTCCCGACATGTTCGACGACTATCATCAGGGCTTCAGGCGGCAGGTCAAGGTCTGGCCTGAGAACCCC
GTCGACAGCTTCCTCCAGGATATCCGCGCCAGAGCTAGGGCGAAAACCCCCGCGGTCACCAAAGCTCGACCCGGC
AGCACCCCGGCCAAGCGGATGGGGAATCCGCTGCCGAGGACGGCTGGAACTTGCACCATCGCCGACCTCGGCTGC
GGAGACGCCCGTCTCGCTGAGTCTCTGGAGGCAGAAAAGCTCAAGCTTCGGCTCAAGCTTCTGAGCTACGACCTC
CACAGCGTCTCCCCCCTGGTCACCAGAGCCGACATCGCCCACCTGCCACTGGAAGACGGCTCCATCAACGTCGCC
ATCTTCTGCCTCGCACTCATGGGCACGAACTGGATCGACTTTATCGAGGAAGCCTATCGCATCCTCCACTGGAAA
GGCGAGCTCTGGGTCGCCGAGATCAAGAGTCGCTTCGGCCCCGTCCGCAACGCCCATAATCCAGTCTCCCACAGC
GTCGGCAACCGCAAGAGACCCGCCGCCAAGGCACCGCGCAGCTCCGAGAAAGACGGCTCCGACGCCGAGGATCTG
GCCGTCGAGGTCGACGGTGTCGAAGACCGCAGGCACCAGACGGACGTGTCAGCCTTTGTCGAGGTGCTCAGGCGC
AGGGGCTTCGTGCTCAGGGGAGAAGCCAACGAGGCCATCGACCTGTCGAACCGCATGTTCGTCAAGATGCACTTC
GTCAAGGCCGCTGCCCCCACGAAAGGGAAAGGCGCCAAGGCGCAGGAGGCTGCCGTCAAGACAACCAAAGGTGCC
GTCGCCAAGAAGTGGCTTGGGAGCGGCACAGGCGACAATACGGAGGACGCGGACGAGGCAGCCATACTCAAACCT
TGTGTCTACAAGACTCGCTGA
Gene >Ophun1|1229
ATGTTTGCTGTACCGGGCTGGTCCGTCTCCGCCGACAGCCTCAAGGCTGAGAAGGCCCCAGCCGGCGACGTGTCC
GAAACGTCCAGATCCAAGAAGCGCAAGAGAGCCGGAACTTCGGTCACGGCGGCCAACGTCGTTGATCTCTACGAG
ACAGTCTTTGAGGGCAAGAAGAAGAAGAATAAGAAGGGAGAGAAGCCTTCTGGCGACGATGGTGGCGCCGCTAAA
GTCCGGACCGCTCAAGATTCACTGAAAGAGAACAAGGCTGCAAAGTCGGACAAGAAGAAAAAGGCCGCCAATCCT
GATGTGAAAGGGGACGCTAAATCACAACTCACCCGACCTAAAGGCGACGAAAATTCGAAGAAGAAGAATGAAGCG
GAAAATCAGAAGAAGCAAAAGCAGCAGCCGAAGCCAGAGTCTCGAGATGCCACCGAGTCCAAACCACCGGCACCC
GCGTCACAACCCGAACCTCCAAAGCAACCCCCAGCCGCAAAACTCACGCCCCTGCAGGCATCTATGAAGGAAAAG
CTCGTGTCCGCCCGGTTCCGTCACCTCAACGAGACGCTCTACACCCGACCCTCGGCCGAAGCTCTGCGGCTCTTC
GACGAATCTCCCGACATGTTCGACGACTATCATCAGGGCTTCAGGCGGCAGGTCAAGGTCTGGCCTGAGAACCCC
GTCGACAGCTTCCTCCAGGATATCCGCGCCAGAGCTAGGGCGAAAACCCCCGCGGTCACCAAAGCTCGACCCGGC
AGCACCCCGGCCAAGCGGATGGGGAATCCGCTGCCGAGGACGGCTGGAACTTGCACCATCGCCGACCTCGGCTGC
GGAGACGCCCGTCTCGCTGAGTCTCTGGAGGCAGAAAAGCTCAAGCTTCGGCTCAAGCTTCTGAGCTACGACCTC
CACAGCGTCTCCCCCCTGGTCACCAGAGCCGACATCGCCCACCTGCCACTGGAAGACGGCTCCATCAACGTCGCC
ATCTTCTGCCTCGCACTCATGGGCACGAACTGGATCGACTTTATCGAGGAAGCCTATCGCATCCTCCACTGGAAA
GGCGAGCTCTGGGTCGCCGAGATCAAGAGTCGCTTCGGCCCCGTCCGCAACGCCCATAATCCAGTCTCCCACAGC
GTCGGCAACCGCAAGAGACCCGCCGCCAAGGCACCGCGCAGCTCCGAGAAAGACGGCTCCGACGCCGAGGATCTG
GCCGTCGAGGTCGACGGTGTCGAAGACCGCAGGCACCAGACGGACGTGTCAGCCTTTGTCGAGGTGCTCAGGCGC
AGGGGCTTCGTGCTCAGGGGAGAAGCCAACGAGGCCATCGACCTGTCGAACCGCATGTTCGTCAAGATGCACTTC
GTCAAGGCCGCTGCCCCCACGAAAGGGAAAGGCGCCAAGGCGCAGGAGGCTGCCGTCAAGACAACCAAAGGTGCC
GTCGCCAAGAAGTGGCTTGGGAGCGGCACAGGCGACAATACGGAGGACGCGGACGAGGCAGCCATACTCAAACCT
TGTGTCTACAAGACTCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail