Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1225
Gene name
LocationContig_148:14529..17344
Strand-
Gene length (bp)2815
Transcript length (bp)2730
Coding sequence length (bp)2730
Protein length (aa) 910

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 2.7E-60 498 889
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 9.3E-55 155 493

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y705|ALP4_SCHPO Spindle pole body component alp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp4 PE=1 SV=1 143 889 0.0E+00
sp|Q5R5J6|GCP2_PONAB Gamma-tubulin complex component 2 OS=Pongo abelii GN=TUBGCP2 PE=2 SV=1 141 876 4.0E-104
sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2 141 876 6.0E-104
sp|Q921G8|GCP2_MOUSE Gamma-tubulin complex component 2 OS=Mus musculus GN=Tubgcp2 PE=1 SV=2 141 902 7.0E-104
sp|Q9C5H9|GACP2_ARATH Gamma-tubulin complex component 2 OS=Arabidopsis thaliana GN=GCP2 PE=1 SV=1 149 810 2.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y705|ALP4_SCHPO Spindle pole body component alp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp4 PE=1 SV=1 143 889 0.0E+00
sp|Q5R5J6|GCP2_PONAB Gamma-tubulin complex component 2 OS=Pongo abelii GN=TUBGCP2 PE=2 SV=1 141 876 4.0E-104
sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2 141 876 6.0E-104
sp|Q921G8|GCP2_MOUSE Gamma-tubulin complex component 2 OS=Mus musculus GN=Tubgcp2 PE=1 SV=2 141 902 7.0E-104
sp|Q9C5H9|GACP2_ARATH Gamma-tubulin complex component 2 OS=Arabidopsis thaliana GN=GCP2 PE=1 SV=1 149 810 2.0E-79
sp|Q9XYP7|GCP2_DROME Gamma-tubulin complex component 2 homolog OS=Drosophila melanogaster GN=Grip84 PE=1 SV=2 139 907 4.0E-68
sp|Q95ZG3|SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum GN=spc97 PE=2 SV=2 151 577 1.0E-48
sp|P38863|SPC97_YEAST Spindle pole body component SPC97 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC97 PE=1 SV=1 149 715 8.0E-35
sp|P58854|GCP3_MOUSE Gamma-tubulin complex component 3 OS=Mus musculus GN=Tubgcp3 PE=1 SV=2 146 853 2.0E-28
sp|O73787|GCP3_XENLA Gamma-tubulin complex component 3 homolog OS=Xenopus laevis GN=tubgcp3 PE=1 SV=1 146 761 6.0E-28
sp|Q96CW5|GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens GN=TUBGCP3 PE=1 SV=2 146 761 4.0E-27
sp|Q9M350|GACP4_ARATH Gamma-tubulin complex component 4 OS=Arabidopsis thaliana GN=GCP4 PE=2 SV=2 330 781 2.0E-20
sp|Q9XYP8|GCP3_DROME Gamma-tubulin complex component 3 homolog OS=Drosophila melanogaster GN=l(1)dd4 PE=1 SV=2 324 763 3.0E-20
sp|Q9USQ2|ALP6_SCHPO Spindle pole body component alp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp6 PE=1 SV=2 353 718 3.0E-15
sp|Q9FG37|GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana GN=GCP3 PE=1 SV=1 148 761 3.0E-15
sp|Q9SC88|GCP4_MEDTR Gamma-tubulin complex component 4 homolog OS=Medicago truncatula GN=85P PE=2 SV=1 477 781 3.0E-12
sp|Q9D4F8|GCP4_MOUSE Gamma-tubulin complex component 4 OS=Mus musculus GN=Tubgcp4 PE=1 SV=2 352 785 3.0E-10
sp|Q9UGJ1|GCP4_HUMAN Gamma-tubulin complex component 4 OS=Homo sapiens GN=TUBGCP4 PE=1 SV=1 352 785 2.0E-09
sp|Q9VKU7|GCP4_DROME Gamma-tubulin complex component 4 homolog OS=Drosophila melanogaster GN=Grip75 PE=1 SV=2 339 763 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0015631 tubulin binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1995
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1103
Ophiocordyceps australis map64 (Brazil) OphauB2|3544
Ophiocordyceps camponoti-floridani Ophcf2|04172
Ophiocordyceps camponoti-rufipedis Ophun1|1225 (this protein)
Ophiocordyceps kimflemingae Ophio5|2139
Ophiocordyceps subramaniannii Hirsu2|2232

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1225
MSTRSSSRANGAGDERSRANGNSFSRSARPDGSRSTDGRRYEERRVTERTYEMHVERVRTSSPEKAARREKRRQK
SPERRAAREQPQHQQQQQVPPPESPSPLAPWKPEVRLLPRTSAPLASRVSMPAVASTVPLAPQPRPLADMSLEAQ
EAAMVEDLLFVFMGYEGQYVRFVKGYNPDDERDRLSGPGFRMVPGLDPSLQDLTQSMLGMATHYAALVAFCDVQS
RDEFGAVNQALCAAVRRFLHDYLVLMAQLETQFLTAGGSFTIHTLRLHTVSTSQMMLQLYSLARELLRKNGLLDE
ESDGDGDGDDDGDSDDYDKVIERLTPGGDLLSASKGICKGGTVLGILTRRLETLSGDPGARALLTTLLREASRPY
MVMLNEWLHHGAINDPHGEFLIKEHKSIRRERLEQDYTDEYWERRYTMRDQPCAPQLDGVRHKVLLAGKYLNVVR
ECGGVDASKRVADVPLTLDDDGFLDNVNNAYAHANASLMQLLLTAHALPARLRSMKHYFFLDPSDYFSYFLELGA
SELRKPVQAVNVGKLQSLLDLVLRQPGSVVALDPFKEDVRVEMKEMTLVKSLQRVVNITGIEQGAEQQPANISSL
TMDQQQQQQQQPLDKNATGFTSLQLDYSVPFPVSLVISRKTVWRYQALFRYLLSLRYLESQLSTTWQTQTRAPSW
AHRGSNAPLEMWKRRAWTLRARMLVFVQQLLYYCTAEVLEPNWNRFMARLQPEMGDEGQKTRMRTVDELMQDHVD
FLDTCLKECMLTNSKLLRIHSKLMQTCTVFAAYTNWLTRELDKADPDLCTSQKPKTMTADQWRRFRANRTPSSQA
AASASTSSKPSEEEAAARVRDLSDIIRKWEANFSRHLQILLDALNHYAATETVVLLSLCARLSAANHGTDYAGLR
AEDDGVASA*
Coding >Ophun1|1225
ATGTCGACACGATCATCGAGTCGCGCCAACGGAGCTGGCGACGAGCGGTCTCGAGCCAATGGCAATAGCTTCTCT
CGATCGGCGAGGCCCGATGGGAGCCGGTCGACGGATGGCAGGCGGTATGAGGAACGGCGGGTGACGGAGCGGACG
TACGAGATGCATGTTGAGCGGGTGCGCACGTCGAGTCCGGAGAAGGCGGCCAGGCGGGAGAAGAGGAGACAGAAG
TCGCCCGAGCGGCGAGCTGCTCGAGAACAGCCGCAACACCAGCAACAGCAGCAAGTGCCTCCTCCGGAATCACCA
TCACCGTTGGCACCGTGGAAGCCTGAGGTGAGGCTTCTGCCGCGGACGTCAGCCCCGTTGGCTTCGAGAGTTTCG
ATGCCGGCTGTGGCGTCGACGGTTCCTCTGGCACCGCAGCCGAGGCCGCTGGCGGACATGTCGCTCGAGGCACAA
GAGGCGGCCATGGTCGAGGACCTGCTATTTGTCTTTATGGGATACGAGGGGCAGTATGTCCGGTTCGTCAAGGGG
TACAACCCGGATGATGAGCGCGACCGGTTATCGGGCCCGGGCTTCAGGATGGTTCCCGGGCTGGACCCGAGTCTG
CAGGACTTGACGCAGTCGATGCTGGGCATGGCGACGCACTACGCTGCTCTCGTGGCCTTTTGCGATGTGCAGAGT
CGGGATGAGTTTGGGGCGGTCAACCAGGCTCTTTGCGCGGCTGTGCGACGTTTCCTGCACGACTACCTGGTGCTG
ATGGCTCAGCTGGAGACTCAGTTTCTGACGGCGGGCGGGAGCTTTACCATTCATACGCTGCGGCTGCATACGGTG
TCGACGAGCCAGATGATGCTGCAGCTGTACTCGCTGGCGCGGGAGCTGCTGAGGAAGAACGGGCTGCTGGACGAG
GAGAGCGACGGGGATGGAGACGGGGACGATGACGGTGATAGCGACGACTACGACAAGGTCATCGAGCGGCTGACG
CCCGGAGGCGATCTCCTCTCTGCCAGCAAGGGCATCTGCAAGGGCGGAACGGTGCTCGGCATCCTGACTCGACGG
CTGGAGACGCTCTCCGGAGACCCCGGGGCGCGAGCCCTCCTGACGACGCTGCTCCGCGAGGCCAGCAGGCCGTAC
ATGGTGATGCTCAACGAGTGGCTTCACCACGGGGCCATCAACGACCCGCACGGCGAGTTCCTCATCAAGGAGCAT
AAGAGCATCCGGCGCGAGCGGCTCGAGCAGGACTACACGGACGAATACTGGGAGAGGCGCTACACGATGCGCGAT
CAGCCCTGCGCTCCTCAGCTGGACGGCGTGCGTCACAAGGTGCTCCTGGCGGGCAAGTATCTCAACGTGGTGCGC
GAGTGCGGAGGCGTCGATGCCAGCAAGCGCGTTGCAGATGTGCCCCTGACGCTGGACGACGATGGCTTCCTCGAC
AACGTCAACAATGCGTACGCGCATGCCAACGCCTCGCTTATGCAGCTGCTGCTGACGGCTCATGCTCTACCTGCT
CGTCTGCGGTCCATGAAGCATTACTTCTTCCTCGACCCGTCCGATTACTTCTCGTATTTTCTGGAGCTGGGGGCT
TCGGAGCTGCGGAAGCCGGTTCAGGCGGTTAATGTGGGCAAGTTGCAGTCGCTTCTCGATCTTGTTCTTCGGCAG
CCGGGGAGTGTCGTTGCTCTGGATCCTTTCAAGGAGGATGTTCGGGTTGAGATGAAGGAGATGACGCTCGTCAAA
TCCCTGCAGCGTGTCGTCAACATCACGGGCATCGAGCAGGGCGCCGAACAGCAACCCGCCAACATCAGCTCTCTA
ACCATGGACCAACAACAACAACAACAACAGCAACCCCTCGATAAGAACGCCACGGGCTTCACCTCGCTACAGCTA
GACTACTCCGTCCCCTTCCCCGTCTCCCTCGTCATCAGCCGCAAAACCGTCTGGCGCTACCAAGCCCTCTTCCGC
TACCTCCTCTCCCTACGCTACCTTGAATCCCAGCTCTCGACGACGTGGCAGACGCAGACGCGGGCTCCGAGCTGG
GCCCATCGCGGAAGCAACGCCCCGCTCGAGATGTGGAAGCGGAGGGCCTGGACGCTGAGGGCGAGGATGTTGGTC
TTTGTGCAGCAGCTGCTTTATTATTGTACTGCTGAGGTGCTGGAGCCGAATTGGAATCGGTTTATGGCTAGGCTG
CAGCCTGAGATGGGAGATGAAGGCCAGAAGACGAGGATGAGGACGGTGGATGAACTGATGCAGGATCACGTCGAT
TTCCTCGATACTTGTCTGAAGGAGTGTATGCTCACCAACAGCAAGCTCCTAAGGATCCATTCCAAGCTGATGCAG
ACCTGCACCGTCTTCGCCGCCTACACAAACTGGCTCACCCGCGAACTCGACAAAGCAGACCCCGACCTCTGCACC
TCCCAAAAGCCCAAGACCATGACGGCCGACCAATGGCGTCGCTTCCGCGCAAACCGAACCCCTTCCTCCCAAGCC
GCCGCATCCGCATCCACATCGTCGAAACCGTCCGAGGAGGAAGCCGCCGCCCGCGTCCGCGACCTCTCCGACATC
ATCCGCAAGTGGGAGGCAAACTTCAGCAGACACCTCCAGATCCTCCTCGACGCCCTCAACCACTACGCCGCTACC
GAGACCGTCGTGCTGCTCAGCCTGTGTGCTAGGCTCAGTGCTGCCAACCACGGGACGGATTATGCTGGGTTGAGG
GCTGAGGATGATGGGGTTGCTTCCGCTTAG
Transcript >Ophun1|1225
ATGTCGACACGATCATCGAGTCGCGCCAACGGAGCTGGCGACGAGCGGTCTCGAGCCAATGGCAATAGCTTCTCT
CGATCGGCGAGGCCCGATGGGAGCCGGTCGACGGATGGCAGGCGGTATGAGGAACGGCGGGTGACGGAGCGGACG
TACGAGATGCATGTTGAGCGGGTGCGCACGTCGAGTCCGGAGAAGGCGGCCAGGCGGGAGAAGAGGAGACAGAAG
TCGCCCGAGCGGCGAGCTGCTCGAGAACAGCCGCAACACCAGCAACAGCAGCAAGTGCCTCCTCCGGAATCACCA
TCACCGTTGGCACCGTGGAAGCCTGAGGTGAGGCTTCTGCCGCGGACGTCAGCCCCGTTGGCTTCGAGAGTTTCG
ATGCCGGCTGTGGCGTCGACGGTTCCTCTGGCACCGCAGCCGAGGCCGCTGGCGGACATGTCGCTCGAGGCACAA
GAGGCGGCCATGGTCGAGGACCTGCTATTTGTCTTTATGGGATACGAGGGGCAGTATGTCCGGTTCGTCAAGGGG
TACAACCCGGATGATGAGCGCGACCGGTTATCGGGCCCGGGCTTCAGGATGGTTCCCGGGCTGGACCCGAGTCTG
CAGGACTTGACGCAGTCGATGCTGGGCATGGCGACGCACTACGCTGCTCTCGTGGCCTTTTGCGATGTGCAGAGT
CGGGATGAGTTTGGGGCGGTCAACCAGGCTCTTTGCGCGGCTGTGCGACGTTTCCTGCACGACTACCTGGTGCTG
ATGGCTCAGCTGGAGACTCAGTTTCTGACGGCGGGCGGGAGCTTTACCATTCATACGCTGCGGCTGCATACGGTG
TCGACGAGCCAGATGATGCTGCAGCTGTACTCGCTGGCGCGGGAGCTGCTGAGGAAGAACGGGCTGCTGGACGAG
GAGAGCGACGGGGATGGAGACGGGGACGATGACGGTGATAGCGACGACTACGACAAGGTCATCGAGCGGCTGACG
CCCGGAGGCGATCTCCTCTCTGCCAGCAAGGGCATCTGCAAGGGCGGAACGGTGCTCGGCATCCTGACTCGACGG
CTGGAGACGCTCTCCGGAGACCCCGGGGCGCGAGCCCTCCTGACGACGCTGCTCCGCGAGGCCAGCAGGCCGTAC
ATGGTGATGCTCAACGAGTGGCTTCACCACGGGGCCATCAACGACCCGCACGGCGAGTTCCTCATCAAGGAGCAT
AAGAGCATCCGGCGCGAGCGGCTCGAGCAGGACTACACGGACGAATACTGGGAGAGGCGCTACACGATGCGCGAT
CAGCCCTGCGCTCCTCAGCTGGACGGCGTGCGTCACAAGGTGCTCCTGGCGGGCAAGTATCTCAACGTGGTGCGC
GAGTGCGGAGGCGTCGATGCCAGCAAGCGCGTTGCAGATGTGCCCCTGACGCTGGACGACGATGGCTTCCTCGAC
AACGTCAACAATGCGTACGCGCATGCCAACGCCTCGCTTATGCAGCTGCTGCTGACGGCTCATGCTCTACCTGCT
CGTCTGCGGTCCATGAAGCATTACTTCTTCCTCGACCCGTCCGATTACTTCTCGTATTTTCTGGAGCTGGGGGCT
TCGGAGCTGCGGAAGCCGGTTCAGGCGGTTAATGTGGGCAAGTTGCAGTCGCTTCTCGATCTTGTTCTTCGGCAG
CCGGGGAGTGTCGTTGCTCTGGATCCTTTCAAGGAGGATGTTCGGGTTGAGATGAAGGAGATGACGCTCGTCAAA
TCCCTGCAGCGTGTCGTCAACATCACGGGCATCGAGCAGGGCGCCGAACAGCAACCCGCCAACATCAGCTCTCTA
ACCATGGACCAACAACAACAACAACAACAGCAACCCCTCGATAAGAACGCCACGGGCTTCACCTCGCTACAGCTA
GACTACTCCGTCCCCTTCCCCGTCTCCCTCGTCATCAGCCGCAAAACCGTCTGGCGCTACCAAGCCCTCTTCCGC
TACCTCCTCTCCCTACGCTACCTTGAATCCCAGCTCTCGACGACGTGGCAGACGCAGACGCGGGCTCCGAGCTGG
GCCCATCGCGGAAGCAACGCCCCGCTCGAGATGTGGAAGCGGAGGGCCTGGACGCTGAGGGCGAGGATGTTGGTC
TTTGTGCAGCAGCTGCTTTATTATTGTACTGCTGAGGTGCTGGAGCCGAATTGGAATCGGTTTATGGCTAGGCTG
CAGCCTGAGATGGGAGATGAAGGCCAGAAGACGAGGATGAGGACGGTGGATGAACTGATGCAGGATCACGTCGAT
TTCCTCGATACTTGTCTGAAGGAGTGTATGCTCACCAACAGCAAGCTCCTAAGGATCCATTCCAAGCTGATGCAG
ACCTGCACCGTCTTCGCCGCCTACACAAACTGGCTCACCCGCGAACTCGACAAAGCAGACCCCGACCTCTGCACC
TCCCAAAAGCCCAAGACCATGACGGCCGACCAATGGCGTCGCTTCCGCGCAAACCGAACCCCTTCCTCCCAAGCC
GCCGCATCCGCATCCACATCGTCGAAACCGTCCGAGGAGGAAGCCGCCGCCCGCGTCCGCGACCTCTCCGACATC
ATCCGCAAGTGGGAGGCAAACTTCAGCAGACACCTCCAGATCCTCCTCGACGCCCTCAACCACTACGCCGCTACC
GAGACCGTCGTGCTGCTCAGCCTGTGTGCTAGGCTCAGTGCTGCCAACCACGGGACGGATTATGCTGGGTTGAGG
GCTGAGGATGATGGGGTTGCTTCCGCTTAG
Gene >Ophun1|1225
ATGTCGACACGATCATCGAGTCGCGCCAACGGAGCTGGCGACGAGCGGTCTCGAGCCAATGGCAATAGCTTCTCT
CGATCGGCGAGGCCCGATGGGAGCCGGTCGACGGATGGCAGGCGGTATGAGGAACGGCGGGTGACGGAGCGGACG
TACGAGATGCATGTTGAGCGGGTGCGCACGTCGAGTCCGGAGAAGGCGGCCAGGCGGGAGAAGAGGAGACAGAAG
TCGCCCGAGCGGCGAGCTGCTCGAGAACAGCCGCAACACCAGCAACAGCAGCAAGTGCCTCCTCCGGAATCACCA
TCACCGTTGGCACCGTGGAAGCCTGAGGTGAGGCTTCTGCCGCGGACGTCAGCCCCGTTGGCTTCGAGAGTTTCG
ATGCCGGCTGTGGCGTCGACGGTTCCTCTGGCACCGCAGCCGAGGCCGCTGGCGGACATGTCGCTCGAGGCACAA
GAGGCGGCCATGGTCGAGGACCTGCTATTTGTCTTTATGGGATACGAGGGGCAGTATGTCCGGTTCGTCAAGGGG
TACAACCCGGATGATGAGCGCGACCGGTTATCGGGCCCGGGCTTCAGGATGGTTCCCGGGCTGGACCCGAGTCTG
CAGGACTTGACGCAGTCGATGCTGGGCATGGCGACGCACTACGCTGCTCTCGTGGCCTTTTGCGATGTGCAGAGT
CGGGATGAGTTTGGGGCGGTCAACCAGGCTCTTTGCGCGGCTGTGCGACGTTTCCTGCACGACTACCTGGTGCTG
ATGGCTCAGCTGGAGACTCAGTTTCTGACGGCGGGCGGGAGCTTTACCATTCATACGCTGCGGCTGCATACGGTG
TCGACGAGCCAGATGATGCTGCAGCTGTACTCGCTGGCGCGGGAGCTGCTGAGGAAGAACGGGCTGCTGGACGAG
GAGAGCGACGGGGATGGAGACGGGGACGATGACGGTGATAGCGACGACTACGACAAGGTCATCGAGCGGCTGACG
CCCGGAGGCGATCTCCTCTCTGCCAGCAAGGGCATCTGCAAGGGCGGAACGGTGCTCGGCATCCTGACTCGACGG
CTGGAGACGCTCTCCGGAGACCCCGGGGCGCGAGCCCTCCTGACGACGCTGCTCCGCGAGGCCAGCAGGCCGTAC
ATGGTGATGCTCAACGAGTGGCTTCACCACGGGGCCATCAACGACCCGCACGGCGAGTTCCTCATCAAGGAGCAT
AAGAGCATCCGGCGCGAGCGGCTCGAGCAGGACTACACGGACGAATACTGGGAGAGGCGCTACACGATGCGCGAT
CAGCCCTGCGCTCCTCAGCTGGACGGCGTGCGTCACAAGGTGCTCCTGGCGGGCAAGTATCTCAACGTGGTGCGC
GAGTGCGGAGGCGTCGATGCCAGCAAGCGCGTTGCAGATGTGCCCCTGACGCTGGACGACGATGGCTTCCTCGAC
AACGTCAACAATGCGTACGCGCATGCCAACGCCTCGCTTATGCAGCTGCTGCTGACGGCTCATGCTCTACCTGCT
CGTCTGCGGTCCATGAAGCATTACTTCTTCCTCGACCCGTCCGATTACTTCTCGTATTTTCTGGAGCTGGGGGCT
TCGGAGCTGCGGAAGCCGGTTCAGGCGGTTAATGTGGGCAAGTTGCAGTCGCTTCTCGATCTTGTTCTTCGGCAG
CCGGGGAGTGTCGTTGCTCTGGATCCTTTCAAGGAGGATGTTCGGGTTGAGATGAAGGAGATGACGCTCGTCAAA
TCCCTGCAGCGTGTCGTCAACATCACGGGCATCGAGCAGGGCGCCGAACAGCAACCCGCCAACATCAGCTCTCTA
ACCATGGACCAACAACAACAACAACAACAGCAACCCCTCGATAAGAACGCCACGGGCTTCACCTCGCTACAGCTA
GACTACTCCGTCCCCTTCCCCGTCTCCCTCGTCATCAGCCGCAAAACCGTCTGGCGCTACCAAGCCCTCTTCCGC
TACCTCCTCTCCCTACGCTACCTTGAATCCCAGCTCTCGACGACGTGGCAGACGCAGACGCGGGCTCCGAGCTGG
GCCCATCGCGGAAGCAACGCCCCGCTCGAGATGTGGAAGCGGAGGGCCTGGACGCTGAGGGCGAGGATGTTGGTC
TTTGTGCAGCAGCTGCTTTATTATTGTACTGCTGAGGTGCTGGAGCCGAATTGGAATCGGTTTATGGCTAGGCTG
CAGCCTGAGATGGGAGATGAAGGCCAGAAGACGAGGATGAGGACGGTGGATGAACTGATGCAGGATCACGTCGAT
TTCCTCGATACTTGTCTGAAGGAGTGTATGCTCACCAACAGCAAGCTCCTAAGGGTAACCCCCCCCCCCCTTTCC
CCCTATCCCTTACCCCTATTTCCTCCTTCAAACTCTCCAGCTAACAATTCCCCCCCTCCCCCAGATCCATTCCAA
GCTGATGCAGACCTGCACCGTCTTCGCCGCCTACACAAACTGGCTCACCCGCGAACTCGACAAAGCAGACCCCGA
CCTCTGCACCTCCCAAAAGCCCAAGACCATGACGGCCGACCAATGGCGTCGCTTCCGCGCAAACCGAACCCCTTC
CTCCCAAGCCGCCGCATCCGCATCCACATCGTCGAAACCGTCCGAGGAGGAAGCCGCCGCCCGCGTCCGCGACCT
CTCCGACATCATCCGCAAGTGGGAGGCAAACTTCAGCAGACACCTCCAGATCCTCCTCGACGCCCTCAACCACTA
CGCCGCTACCGAGACCGTCGTGCTGCTCAGCCTGTGTGCTAGGCTCAGTGCTGCCAACCACGGGACGGATTATGC
TGGGTTGAGGGCTGAGGATGATGGGGTTGCTTCCGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail