Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1217
Gene name
LocationContig_1477:100..1737
Strand-
Gene length (bp)1637
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74910|RAF1_SCHPO Rik1-associated factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=raf1 PE=1 SV=1 93 498 2.0E-13

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2550
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1390
Ophiocordyceps australis map64 (Brazil) OphauB2|3696
Ophiocordyceps camponoti-floridani Ophcf2|01580
Ophiocordyceps camponoti-rufipedis Ophun1|1217 (this protein)
Ophiocordyceps kimflemingae Ophio5|5583
Ophiocordyceps subramaniannii Hirsu2|3777

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1217
MSCLTALCFRHHVPSLVGDALPRRTEQDVYNFCADLIAGKAADPQRAGTLSLDVEAEAGRRSGLQSSRVSSLLLA
RELDGNAGFGRTRRYANFQNEFTRALEDSLAVVAEFTGCAGDIAAVSWVSDGELVCGTTAHSDAHNQQYNKPGNL
LVGSVEAGTLRAMDHHRIPRPRVERGDNASEAMRQSQDPWLYCSVVSSDYDAISRRAFTSSFDWTVKVWEMVDGK
GIMCVGTWHHGGNVNFVEAARDGSGRVATAADVSSQAVRIYSLRQDDVNASPYLALSSTRSSGQLWAYFPATMRW
GRAPLARHLLLVGYSPRGQGGDVDIPEDRRNTGELMLWDASRAVRVPVLTATTANVFEVAWHPTMCRFIVATSPS
GLPTEKQQRVRTQIRIFQQDLDRADGAYSEFQKLDCAAADINELTIMPNSLRHAYVTAGCTDGIVYVWDTAQGDD
PLHLLRHGDPLDDFSYDREKEDTGVKFTAWGSTPDRFYTGSSDGVVKAVSSLG*
Coding >Ophun1|1217
ATGAGCTGTTTGACGGCGCTTTGCTTCCGACACCACGTCCCGTCTCTCGTGGGCGATGCCCTACCGCGTCGAACG
GAGCAGGACGTCTACAACTTCTGCGCCGATCTCATCGCCGGCAAGGCGGCGGATCCGCAGCGGGCTGGCACGCTA
TCGCTCGACGTCGAGGCCGAAGCCGGACGACGATCCGGGTTGCAGAGCAGCCGGGTATCGTCACTGCTGCTAGCG
AGGGAGCTCGACGGCAACGCAGGATTCGGACGGACGAGACGGTACGCGAATTTCCAGAATGAGTTTACGCGCGCG
CTGGAGGATTCCTTGGCTGTGGTTGCCGAGTTTACGGGCTGCGCTGGCGATATCGCTGCCGTGTCGTGGGTGTCG
GATGGGGAGCTTGTTTGCGGGACGACGGCCCATTCTGACGCGCATAACCAGCAGTATAACAAGCCCGGCAACTTA
CTTGTAGGCTCCGTCGAAGCGGGCACGCTGCGAGCCATGGATCACCACCGGATACCGAGGCCGAGGGTGGAAAGG
GGCGACAACGCGAGCGAGGCGATGCGGCAGAGTCAGGACCCGTGGCTATACTGCTCCGTCGTTTCTTCCGACTAC
GATGCCATCAGCCGTCGGGCATTTACCTCGAGCTTCGACTGGACCGTCAAGGTTTGGGAGATGGTGGACGGGAAG
GGCATCATGTGTGTTGGCACGTGGCATCACGGCGGGAACGTCAACTTTGTCGAGGCTGCGCGCGATGGTTCGGGT
CGGGTGGCGACGGCGGCGGACGTGTCTTCGCAGGCAGTTCGCATCTACAGCCTCCGACAAGACGACGTCAACGCA
AGTCCCTACCTCGCCCTCTCGTCGACACGAAGCAGCGGCCAGCTGTGGGCATACTTCCCAGCGACGATGCGTTGG
GGAAGGGCTCCCCTGGCTCGCCATCTCCTTCTAGTCGGCTACTCCCCGCGAGGCCAAGGCGGCGACGTCGACATC
CCCGAAGACCGGCGCAACACGGGCGAGCTGATGCTCTGGGACGCGTCGCGGGCTGTCCGCGTGCCAGTCCTCACA
GCCACCACGGCAAACGTCTTCGAAGTAGCCTGGCACCCAACCATGTGCCGCTTCATCGTCGCCACCTCCCCCAGC
GGCCTCCCCACCGAGAAGCAGCAGCGCGTGCGCACGCAGATCCGCATCTTCCAGCAGGACCTCGACCGAGCAGAC
GGCGCGTACAGCGAGTTCCAGAAGCTGGACTGCGCGGCCGCGGACATCAACGAGTTGACCATCATGCCCAACTCG
CTACGACACGCCTACGTCACGGCTGGGTGCACAGACGGCATCGTCTACGTGTGGGATACGGCGCAGGGCGATGAC
CCCCTACACCTCCTCCGTCACGGCGATCCGCTCGACGACTTTTCCTATGATCGCGAGAAGGAGGATACGGGCGTC
AAGTTTACGGCTTGGGGTTCGACGCCTGATCGGTTCTACACGGGGTCGAGTGATGGGGTTGTCAAGGCTGTTTCT
TCTCTCGGTTGA
Transcript >Ophun1|1217
ATGAGCTGTTTGACGGCGCTTTGCTTCCGACACCACGTCCCGTCTCTCGTGGGCGATGCCCTACCGCGTCGAACG
GAGCAGGACGTCTACAACTTCTGCGCCGATCTCATCGCCGGCAAGGCGGCGGATCCGCAGCGGGCTGGCACGCTA
TCGCTCGACGTCGAGGCCGAAGCCGGACGACGATCCGGGTTGCAGAGCAGCCGGGTATCGTCACTGCTGCTAGCG
AGGGAGCTCGACGGCAACGCAGGATTCGGACGGACGAGACGGTACGCGAATTTCCAGAATGAGTTTACGCGCGCG
CTGGAGGATTCCTTGGCTGTGGTTGCCGAGTTTACGGGCTGCGCTGGCGATATCGCTGCCGTGTCGTGGGTGTCG
GATGGGGAGCTTGTTTGCGGGACGACGGCCCATTCTGACGCGCATAACCAGCAGTATAACAAGCCCGGCAACTTA
CTTGTAGGCTCCGTCGAAGCGGGCACGCTGCGAGCCATGGATCACCACCGGATACCGAGGCCGAGGGTGGAAAGG
GGCGACAACGCGAGCGAGGCGATGCGGCAGAGTCAGGACCCGTGGCTATACTGCTCCGTCGTTTCTTCCGACTAC
GATGCCATCAGCCGTCGGGCATTTACCTCGAGCTTCGACTGGACCGTCAAGGTTTGGGAGATGGTGGACGGGAAG
GGCATCATGTGTGTTGGCACGTGGCATCACGGCGGGAACGTCAACTTTGTCGAGGCTGCGCGCGATGGTTCGGGT
CGGGTGGCGACGGCGGCGGACGTGTCTTCGCAGGCAGTTCGCATCTACAGCCTCCGACAAGACGACGTCAACGCA
AGTCCCTACCTCGCCCTCTCGTCGACACGAAGCAGCGGCCAGCTGTGGGCATACTTCCCAGCGACGATGCGTTGG
GGAAGGGCTCCCCTGGCTCGCCATCTCCTTCTAGTCGGCTACTCCCCGCGAGGCCAAGGCGGCGACGTCGACATC
CCCGAAGACCGGCGCAACACGGGCGAGCTGATGCTCTGGGACGCGTCGCGGGCTGTCCGCGTGCCAGTCCTCACA
GCCACCACGGCAAACGTCTTCGAAGTAGCCTGGCACCCAACCATGTGCCGCTTCATCGTCGCCACCTCCCCCAGC
GGCCTCCCCACCGAGAAGCAGCAGCGCGTGCGCACGCAGATCCGCATCTTCCAGCAGGACCTCGACCGAGCAGAC
GGCGCGTACAGCGAGTTCCAGAAGCTGGACTGCGCGGCCGCGGACATCAACGAGTTGACCATCATGCCCAACTCG
CTACGACACGCCTACGTCACGGCTGGGTGCACAGACGGCATCGTCTACGTGTGGGATACGGCGCAGGGCGATGAC
CCCCTACACCTCCTCCGTCACGGCGATCCGCTCGACGACTTTTCCTATGATCGCGAGAAGGAGGATACGGGCGTC
AAGTTTACGGCTTGGGGTTCGACGCCTGATCGGTTCTACACGGGGTCGAGTGATGGGGTTGTCAAGGCTGTTTCT
TCTCTCGGTTGA
Gene >Ophun1|1217
ATGAGCTGTTTGACGGCGCTTTGCTTCCGACACCACGTCCCGTCTCTCGTGGGCGATGCCCTACCGCGTCGAACG
GAGCAGGACGTCTACAACTTCTGCGCCGATCTCATCGCCGGCAAGGCGGCGGATCCGCAGCGGGCTGGCACGCTA
TCGCTCGACGTCGAGGCCGAAGCCGGACGACGATCCGGGTTGCAGAGCAGCCGGGTATCGTCACTGCTGCTAGCG
AGGGAGCTCGACGGCAACGCAGGATTCGGACGGACGAGACGGTACGCGAATTTCCAGAATGAGTTTACGCGCGCG
CTGGAGGATTCCTTGGCTGTGGTTGCCGAGTTTACGGGCTGCGCTGGCGATATCGCTGCCGTGTCGTGGGTGTCG
GATGGGGAGCTTGTTTGCGGGACGACGGCCCATTCTGACGCGCATAACCAGCAGTATAACAAGCCCGGCAACTTA
CTTGTAGGCTCCGTCGAAGCGGGCACGCTGCGAGCCATGGATCACCACCGGATACCGAGGCCGAGGGTGGAAAGG
GGCGACAACGCGAGCGAGGCGATGCGGCAGAGTCAGGACCCGTGGCTATACTGCTCCGTCGTTTCTTCCGACTAC
GATGCCATCAGCCGTCGGGCATTTACCTCGAGCTTCGACTGGACCGTCAAGGTTTGGGAGATGGTGGACGGGAAG
GGCATCATGTGTGTTGGCACGTGGCATCACGGCGGGAACGTCAACTTTGTCGAGGCTGCGCGCGATGGTTCGGGT
CGGGTGGCGACGGCGGCGGACGTGTCTTCGCAGGCAGTTCGCATCTACAGCCTCCGACAAGACGACGTCAACGCA
AGTCCCTACCTCGCCCTCTCGTCGACACGAAGCAGCGGCCAGCTGTGGGCATACTTCCCAGCGACGATGCGTTGG
GGAAGGGCTCCCCTGGCTCGCCATCTCCTTCTAGTCGGCTACTCCCCGCGAGGCCAAGGCGGCGACGTCGACATC
CCCGAAGACCGGCGCAACACGGGCGAGCTGATGCTCTGGGACGCGTCGCGGGCTGTCCGCGTGCCAGTCCTCACA
GCCACCACGGCAAACGTCTTCGAAGTAGCCTGGCACCCAACCATGTGCCGCTTCATCGTCGCCACCTCCCCCAGC
GGCCTCCCCACCGAGAAGCAGCAGCGCGTGCGCACGCAGATCCGCATCTTCCAGCAGGACCTCGACCGAGCAGAC
GGCGCGTACAGCGAGTTCCAGAAGCTGGACTGCGCGGCCGCGGACATCAACGAGTTGACCATCATGCCCAACTCG
CTACGACACGCCTACGTCACGGCTGGGTGCACAGACGGCATCGTCTACGTGTGGGATACGGCGCAGGGCGATGAC
CCCCTACACCTCCTCCGTCACGGCGATCCGCTCGACGACTTTTCCTATGATCGCGAGAAGGAGGATACGGGCGTC
AAGTTTACGGCTTGGGGTTCGACGCCTGATCGGTTCTACACGGGGTCGAGTGATGGGGTTGTCAAGGTGTGGAAT
GTGCGGAATCGGCGTCGGCCGTTGGTTCGCGTTGTGCTTGAGGCGCCTGGTCCCATCTCTGTTGGCGTCTTTTCT
CCGGATGGGTCGAGGCTTGCGGTTGGGGATGCTACGGGGAGGCTGTTTCTTCTCTCGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail