Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1213
Gene name
LocationContig_1470:152..1238
Strand+
Gene length (bp)1086
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06766 Hydrophobin_2 Fungal hydrophobin 5.7E-16 84 138

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P52753|CRYP_CRYPA Cryparin OS=Cryphonectria parasitica GN=CRP PE=1 SV=1 83 138 7.0E-11
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 82 138 1.0E-10
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 88 138 6.0E-08
sp|P52755|QID3_TRIHA Cell wall protein qid3 OS=Trichoderma harzianum GN=qid3 PE=2 SV=1 84 138 3.0E-07
sp|P52754|HYP1_HYPJE Hydrophobin-1 OS=Hypocrea jecorina GN=hfb1 PE=1 SV=1 79 138 7.0E-07

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 29 0.999641

Transmembrane Domains

Domain # Start End Length
1 12 29 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup136
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6106
Ophiocordyceps australis 1348a (Ghana) OphauG2|989
Ophiocordyceps australis map64 (Brazil) OphauB2|4594
Ophiocordyceps australis map64 (Brazil) OphauB2|5882
Ophiocordyceps camponoti-floridani Ophcf2|00473
Ophiocordyceps camponoti-rufipedis Ophun1|1213 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3829
Ophiocordyceps camponoti-rufipedis Ophun1|6587
Ophiocordyceps kimflemingae Ophio5|1277
Ophiocordyceps kimflemingae Ophio5|22
Ophiocordyceps subramaniannii Hirsu2|10919
Ophiocordyceps subramaniannii Hirsu2|1373
Ophiocordyceps subramaniannii Hirsu2|5330
Ophiocordyceps subramaniannii Hirsu2|640

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1213
MSSYNLVKSRTTINIKFLALTLLLVGALAKRTNLHYGGISGGGGNNGGGDNGGGGGNNGGGGSNTGGGGGGGSSG
SGGGGGYSCSPSLYSNVACCATDVPGLDLDCQPPRSHTSLADFNAVCAGIGKRARCCVLPVLG*
Coding >Ophun1|1213
ATGTCTAGCTATAATCTAGTTAAGTCCCGAACAACTATTAATATAAAGTTCCTCGCCCTTACCCTCCTCCTCGTC
GGCGCTCTCGCTAAACGTACTAACTTACACTACGGCGGTATTAGCGGCGGCGGCGGCAACAACGGAGGCGGCGAC
AACGGAGGCGGAGGCGGCAACAACGGCGGCGGTGGCAGCAACACTGGCGGAGGCGGCGGTGGCGGTAGTAGTGGT
AGTGGCGGCGGCGGTGGCTACTCTTGCTCTCCCAGCCTTTACAGCAACGTCGCGTGCTGTGCTACCGACGTCCCC
GGCCTTGATTTAGACTGCCAGCCTCCCCGGTCTCATACTAGCCTCGCCGACTTCAACGCCGTCTGCGCTGGAATT
GGAAAGCGTGCCCGCTGCTGCGTCCTCCCCGTGCTTGGCTAG
Transcript >Ophun1|1213
ATGTCTAGCTATAATCTAGTTAAGTCCCGAACAACTATTAATATAAAGTTCCTCGCCCTTACCCTCCTCCTCGTC
GGCGCTCTCGCTAAACGTACTAACTTACACTACGGCGGTATTAGCGGCGGCGGCGGCAACAACGGAGGCGGCGAC
AACGGAGGCGGAGGCGGCAACAACGGCGGCGGTGGCAGCAACACTGGCGGAGGCGGCGGTGGCGGTAGTAGTGGT
AGTGGCGGCGGCGGTGGCTACTCTTGCTCTCCCAGCCTTTACAGCAACGTCGCGTGCTGTGCTACCGACGTCCCC
GGCCTTGATTTAGACTGCCAGCCTCCCCGGTCTCATACTAGCCTCGCCGACTTCAACGCCGTCTGCGCTGGAATT
GGAAAGCGTGCCCGCTGCTGCGTCCTCCCCGTGCTTGGCTAG
Gene >Ophun1|1213
ATGTCTAGCTATAATCTAGGTACTACGCTTTAATATAGGGTAGCTACGCTTTAGAATAGGGTAGCTACGTAGAAG
AGGTAGAAGAGCCCTATCTTTATTAGTTTTTTATTAGTATATATATTATAATACTACTTAAATATTTATTAAATA
TCTCTTTATTACTAAGATAAAATATTACGCTATTTTTTAAAGGGAAGTTAGCTACCCTTATTACTATAACTAATT
TAAAGGTATTATTATAACTTAAAAAATACTTGCTAAAAAGCCTTAGGCTAGCGCTATTAATAATAATAATAAGCG
TATGCTTATTACTAGTTCTTAGTATAAGTAGCTTTACTTAGCTAATAGAACTAGTTAAGTAAGTAAGTTATTAAT
TAGTAGTTAATACTTAATTATTTTTATATAGAATTATAAGTATTTTATACATAGCGTATATAGAAAGTAGAAATA
AGTACTATTTAGTAAGTCTAACTTTTACTACTAATAAAGGTATATTTATAAATATATAATAACTTTCTAAAGTAG
TAGTTAATTTAATACGTCCTATAGTTAAGTTCTTTTATTATAAAGAAGGAATTAGTAATAACAACGCTATATAGT
AGCATAACCTATACTAAGAGGCTACTAAGCTTTAAACTCTAACTACCTATACCTAGGCATCTAGCCTAGCTTTCC
TCTCCCTCCTTAGTTAAGTCCCGAACAACTATTAATATAAAGTTCCTCGCCCTTACCCTCCTCCTCGTCGGCGCT
CTCGCTAAACGTACTAACTTACACTACGGCGGTATTAGCGGCGGCGGCGGCAACAACGGAGGCGGCGACAACGGA
GGCGGAGGCGGCAACAACGGCGGCGGTGGCAGCAACACTGGCGGAGGCGGCGGTGGCGGTAGTAGTGGTAGTGGC
GGCGGCGGTGGCTACTCTTGCTCTCCCAGCCTTTACAGCAACGTCGCGTGCTGTGCTACCGACGTCCCCGGCCTT
GATTTAGACTGCCAGCCTCCCCGGTCTCATACTAGCCTCGCCGACTTCAACGCCGTCTGCGCTGGAATTGGAAAG
CGTGCCCGCTGCTGCGTCCTCCCCGTGCTTGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail