Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1213
Gene name
LocationContig_1470:152..1238
Strand+
Gene length (bp)1086
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06766 Hydrophobin_2 Fungal hydrophobin 5.7E-16 84 138

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P52753|CRYP_CRYPA Cryparin OS=Cryphonectria parasitica GN=CRP PE=1 SV=1 83 138 7.0E-11
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 82 138 1.0E-10
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 88 138 6.0E-08
sp|P52755|QID3_TRIHA Cell wall protein qid3 OS=Trichoderma harzianum GN=qid3 PE=2 SV=1 84 138 3.0E-07
sp|P52754|HYP1_HYPJE Hydrophobin-1 OS=Hypocrea jecorina GN=hfb1 PE=1 SV=1 79 138 7.0E-07

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 12 29 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1213
MSSYNLVKSRTTINIKFLALTLLLVGALAKRTNLHYGGISGGGGNNGGGDNGGGGGNNGGGGSNTGGGGGGGSSG
SGGGGGYSCSPSLYSNVACCATDVPGLDLDCQPPRSHTSLADFNAVCAGIGKRARCCVLPVLG*
Coding >Ophun1|1213
ATGTCTAGCTATAATCTAGTTAAGTCCCGAACAACTATTAATATAAAGTTCCTCGCCCTTACCCTCCTCCTCGTC
GGCGCTCTCGCTAAACGTACTAACTTACACTACGGCGGTATTAGCGGCGGCGGCGGCAACAACGGAGGCGGCGAC
AACGGAGGCGGAGGCGGCAACAACGGCGGCGGTGGCAGCAACACTGGCGGAGGCGGCGGTGGCGGTAGTAGTGGT
AGTGGCGGCGGCGGTGGCTACTCTTGCTCTCCCAGCCTTTACAGCAACGTCGCGTGCTGTGCTACCGACGTCCCC
GGCCTTGATTTAGACTGCCAGCCTCCCCGGTCTCATACTAGCCTCGCCGACTTCAACGCCGTCTGCGCTGGAATT
GGAAAGCGTGCCCGCTGCTGCGTCCTCCCCGTGCTTGGCTAG
Transcript >Ophun1|1213
ATGTCTAGCTATAATCTAGTTAAGTCCCGAACAACTATTAATATAAAGTTCCTCGCCCTTACCCTCCTCCTCGTC
GGCGCTCTCGCTAAACGTACTAACTTACACTACGGCGGTATTAGCGGCGGCGGCGGCAACAACGGAGGCGGCGAC
AACGGAGGCGGAGGCGGCAACAACGGCGGCGGTGGCAGCAACACTGGCGGAGGCGGCGGTGGCGGTAGTAGTGGT
AGTGGCGGCGGCGGTGGCTACTCTTGCTCTCCCAGCCTTTACAGCAACGTCGCGTGCTGTGCTACCGACGTCCCC
GGCCTTGATTTAGACTGCCAGCCTCCCCGGTCTCATACTAGCCTCGCCGACTTCAACGCCGTCTGCGCTGGAATT
GGAAAGCGTGCCCGCTGCTGCGTCCTCCCCGTGCTTGGCTAG
Gene >Ophun1|1213
ATGTCTAGCTATAATCTAGGTACTACGCTTTAATATAGGGTAGCTACGCTTTAGAATAGGGTAGCTACGTAGAAG
AGGTAGAAGAGCCCTATCTTTATTAGTTTTTTATTAGTATATATATTATAATACTACTTAAATATTTATTAAATA
TCTCTTTATTACTAAGATAAAATATTACGCTATTTTTTAAAGGGAAGTTAGCTACCCTTATTACTATAACTAATT
TAAAGGTATTATTATAACTTAAAAAATACTTGCTAAAAAGCCTTAGGCTAGCGCTATTAATAATAATAATAAGCG
TATGCTTATTACTAGTTCTTAGTATAAGTAGCTTTACTTAGCTAATAGAACTAGTTAAGTAAGTAAGTTATTAAT
TAGTAGTTAATACTTAATTATTTTTATATAGAATTATAAGTATTTTATACATAGCGTATATAGAAAGTAGAAATA
AGTACTATTTAGTAAGTCTAACTTTTACTACTAATAAAGGTATATTTATAAATATATAATAACTTTCTAAAGTAG
TAGTTAATTTAATACGTCCTATAGTTAAGTTCTTTTATTATAAAGAAGGAATTAGTAATAACAACGCTATATAGT
AGCATAACCTATACTAAGAGGCTACTAAGCTTTAAACTCTAACTACCTATACCTAGGCATCTAGCCTAGCTTTCC
TCTCCCTCCTTAGTTAAGTCCCGAACAACTATTAATATAAAGTTCCTCGCCCTTACCCTCCTCCTCGTCGGCGCT
CTCGCTAAACGTACTAACTTACACTACGGCGGTATTAGCGGCGGCGGCGGCAACAACGGAGGCGGCGACAACGGA
GGCGGAGGCGGCAACAACGGCGGCGGTGGCAGCAACACTGGCGGAGGCGGCGGTGGCGGTAGTAGTGGTAGTGGC
GGCGGCGGTGGCTACTCTTGCTCTCCCAGCCTTTACAGCAACGTCGCGTGCTGTGCTACCGACGTCCCCGGCCTT
GATTTAGACTGCCAGCCTCCCCGGTCTCATACTAGCCTCGCCGACTTCAACGCCGTCTGCGCTGGAATTGGAAAG
CGTGCCCGCTGCTGCGTCCTCCCCGTGCTTGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail