Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1208
Gene name
LocationContig_147:19380..21273
Strand-
Gene length (bp)1893
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 3.0E-09 37 204

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 16 204 5.0E-08
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 16 204 6.0E-08

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 31 0.955768

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5083
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|04139
Ophiocordyceps camponoti-rufipedis Ophun1|1208 (this protein)
Ophiocordyceps kimflemingae Ophio5|3240
Ophiocordyceps subramaniannii Hirsu2|2982
Ophiocordyceps subramaniannii Hirsu2|405

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1208
MTPPRHIIQALSAASLFLPSTATPLFTRSDADPPATVYRGDSRPPAAIKANGGFHPWGEYWHAERAFSLENHLFV
NEDFLEAVWDQLCYREEDRGPAPELHVNYTTAYVSTTTSPQEAAEFASGGWVYIMQATPNMLLLQENLFDEVLAL
GGVYWSQVRGFIRAVDWTQSSFADMVRDGRYSPNPDFDEERWGGLTVSEVPEGWDSLHPAQSAHELMDSVGGSVG
WNGSFPLLPPETVRTGDAVISVDRRPAGDVRGTSRQLPDASPGNPRPAPDHLPGTSGQPPGYLPGASQQPQNLPG
PSRRPLEPPEDLPGSSRQPPDDQQRASRQPPSRCSAPDASPNTNSCPPSRNRQSLEYVSLNNTNDSLESPFKKQR
KVALDLIDDRLPTTLAPSEGIIPEEIRHRIEQGIQTEQDCMFVLSQLNSMFPMLLHSSILRRSSSNARHCEELLA
WLPRTLLFLIWEGSRGRCPPCQKIDGLEVEVSIAEGALAGTWDTVLVGVAGMTPHLVMATGPEAGYRVRKRFDLK
SVFGEKEVYLRDVDSVSLIDHAQGSVMERDKWTLQGVRMWARCAASSQMLRVDRYRDLRLGLRHGRSWGPEVVWS
DRIELGDWRTE*
Coding >Ophun1|1208
ATGACACCTCCACGACACATCATCCAAGCCCTATCAGCAGCATCTCTCTTTCTACCCTCCACCGCAACCCCCCTA
TTCACCCGCTCCGATGCCGACCCCCCAGCCACCGTCTACCGCGGAGACTCCCGCCCCCCAGCCGCCATCAAAGCA
AACGGCGGCTTCCACCCCTGGGGCGAATACTGGCACGCAGAACGAGCCTTCAGCCTAGAAAACCACCTCTTCGTC
AACGAGGACTTCCTCGAAGCAGTATGGGACCAGCTCTGCTACCGGGAGGAAGACCGCGGGCCAGCACCCGAGCTC
CACGTCAACTACACAACCGCCTACGTGTCGACGACGACATCCCCCCAGGAGGCGGCCGAGTTCGCCTCAGGCGGA
TGGGTCTACATCATGCAGGCGACGCCCAACATGCTGCTGCTGCAGGAGAATCTCTTTGACGAGGTTCTAGCTCTG
GGCGGCGTTTACTGGTCTCAGGTAAGGGGCTTCATCCGTGCCGTCGACTGGACGCAGTCTTCCTTCGCCGACATG
GTCCGCGACGGCCGGTATAGCCCTAACCCGGACTTTGACGAGGAGAGATGGGGGGGTCTGACGGTATCGGAGGTT
CCGGAGGGCTGGGATTCTCTTCATCCGGCGCAGTCGGCTCACGAGTTGATGGATTCCGTGGGGGGTTCGGTCGGA
TGGAACGGGAGTTTCCCGCTTCTTCCTCCGGAGACGGTGCGGACGGGAGACGCTGTTATTTCTGTGGATAGACGG
CCGGCGGGGGATGTGCGGGGGACGTCCCGACAGCTTCCGGATGCTTCACCGGGCAACCCCCGGCCGGCTCCGGAT
CACCTACCCGGTACCTCCGGACAGCCCCCGGGGTATCTCCCGGGCGCCTCTCAACAACCGCAGAACCTCCCCGGA
CCCTCCCGACGACCCCTGGAACCGCCGGAGGATCTCCCCGGTTCCTCTCGTCAACCCCCTGATGATCAACAGCGT
GCCTCCCGCCAGCCCCCAAGCAGATGCTCCGCCCCGGATGCATCCCCCAACACCAACTCCTGTCCCCCATCCCGC
AACCGCCAAAGCCTCGAGTACGTCTCCTTGAACAACACGAACGACAGCCTCGAATCCCCATTCAAGAAGCAAAGG
AAAGTAGCACTAGACCTCATCGACGACCGCCTACCCACCACTCTCGCACCCTCCGAAGGCATCATCCCCGAGGAA
ATCCGCCACCGAATCGAGCAGGGCATCCAAACCGAGCAGGACTGCATGTTCGTCCTCAGCCAGCTAAACTCCATG
TTCCCCATGCTCCTCCACTCCAGCATCCTCCGCCGATCATCATCAAATGCCCGCCACTGCGAAGAGCTGTTGGCC
TGGCTGCCTCGCACCTTGCTCTTCCTCATCTGGGAGGGTTCCCGCGGCAGATGTCCTCCCTGCCAGAAGATTGAT
GGGCTGGAGGTTGAGGTGAGTATCGCGGAGGGGGCGCTGGCTGGGACGTGGGATACGGTTTTGGTGGGTGTGGCG
GGGATGACGCCTCATCTGGTGATGGCGACGGGGCCGGAGGCGGGATACAGGGTGAGAAAGAGGTTTGATCTCAAG
AGTGTGTTTGGGGAGAAGGAGGTTTATCTCCGGGATGTGGACAGCGTCAGCCTCATTGATCACGCTCAGGGTAGC
GTCATGGAGCGGGATAAATGGACGCTGCAAGGCGTCAGGATGTGGGCTCGCTGTGCCGCCTCGTCGCAGATGCTA
CGCGTTGATCGGTATCGCGATCTGCGGCTTGGTCTGCGGCATGGGAGGAGCTGGGGGCCGGAAGTGGTTTGGTCT
GATAGGATCGAGCTGGGGGATTGGAGGACTGAGTGA
Transcript >Ophun1|1208
ATGACACCTCCACGACACATCATCCAAGCCCTATCAGCAGCATCTCTCTTTCTACCCTCCACCGCAACCCCCCTA
TTCACCCGCTCCGATGCCGACCCCCCAGCCACCGTCTACCGCGGAGACTCCCGCCCCCCAGCCGCCATCAAAGCA
AACGGCGGCTTCCACCCCTGGGGCGAATACTGGCACGCAGAACGAGCCTTCAGCCTAGAAAACCACCTCTTCGTC
AACGAGGACTTCCTCGAAGCAGTATGGGACCAGCTCTGCTACCGGGAGGAAGACCGCGGGCCAGCACCCGAGCTC
CACGTCAACTACACAACCGCCTACGTGTCGACGACGACATCCCCCCAGGAGGCGGCCGAGTTCGCCTCAGGCGGA
TGGGTCTACATCATGCAGGCGACGCCCAACATGCTGCTGCTGCAGGAGAATCTCTTTGACGAGGTTCTAGCTCTG
GGCGGCGTTTACTGGTCTCAGGTAAGGGGCTTCATCCGTGCCGTCGACTGGACGCAGTCTTCCTTCGCCGACATG
GTCCGCGACGGCCGGTATAGCCCTAACCCGGACTTTGACGAGGAGAGATGGGGGGGTCTGACGGTATCGGAGGTT
CCGGAGGGCTGGGATTCTCTTCATCCGGCGCAGTCGGCTCACGAGTTGATGGATTCCGTGGGGGGTTCGGTCGGA
TGGAACGGGAGTTTCCCGCTTCTTCCTCCGGAGACGGTGCGGACGGGAGACGCTGTTATTTCTGTGGATAGACGG
CCGGCGGGGGATGTGCGGGGGACGTCCCGACAGCTTCCGGATGCTTCACCGGGCAACCCCCGGCCGGCTCCGGAT
CACCTACCCGGTACCTCCGGACAGCCCCCGGGGTATCTCCCGGGCGCCTCTCAACAACCGCAGAACCTCCCCGGA
CCCTCCCGACGACCCCTGGAACCGCCGGAGGATCTCCCCGGTTCCTCTCGTCAACCCCCTGATGATCAACAGCGT
GCCTCCCGCCAGCCCCCAAGCAGATGCTCCGCCCCGGATGCATCCCCCAACACCAACTCCTGTCCCCCATCCCGC
AACCGCCAAAGCCTCGAGTACGTCTCCTTGAACAACACGAACGACAGCCTCGAATCCCCATTCAAGAAGCAAAGG
AAAGTAGCACTAGACCTCATCGACGACCGCCTACCCACCACTCTCGCACCCTCCGAAGGCATCATCCCCGAGGAA
ATCCGCCACCGAATCGAGCAGGGCATCCAAACCGAGCAGGACTGCATGTTCGTCCTCAGCCAGCTAAACTCCATG
TTCCCCATGCTCCTCCACTCCAGCATCCTCCGCCGATCATCATCAAATGCCCGCCACTGCGAAGAGCTGTTGGCC
TGGCTGCCTCGCACCTTGCTCTTCCTCATCTGGGAGGGTTCCCGCGGCAGATGTCCTCCCTGCCAGAAGATTGAT
GGGCTGGAGGTTGAGGTGAGTATCGCGGAGGGGGCGCTGGCTGGGACGTGGGATACGGTTTTGGTGGGTGTGGCG
GGGATGACGCCTCATCTGGTGATGGCGACGGGGCCGGAGGCGGGATACAGGGTGAGAAAGAGGTTTGATCTCAAG
AGTGTGTTTGGGGAGAAGGAGGTTTATCTCCGGGATGTGGACAGCGTCAGCCTCATTGATCACGCTCAGGGTAGC
GTCATGGAGCGGGATAAATGGACGCTGCAAGGCGTCAGGATGTGGGCTCGCTGTGCCGCCTCGTCGCAGATGCTA
CGCGTTGATCGGTATCGCGATCTGCGGCTTGGTCTGCGGCATGGGAGGAGCTGGGGGCCGGAAGTGGTTTGGTCT
GATAGGATCGAGCTGGGGGATTGGAGGACTGAGTGA
Gene >Ophun1|1208
ATGACACCTCCACGACACATCATCCAAGCCCTATCAGCAGCATCTCTCTTTCTACCCTCCACCGCAACCCCCCTA
TTCACCCGCTCCGATGCCGACCCCCCAGCCACCGTCTACCGCGGAGACTCCCGCCCCCCAGCCGCCATCAAAGCA
AACGGCGGCTTCCACCCCTGGGGCGAATACTGGCACGCAGAACGAGCCTTCAGCCTAGAAAACCACCTCTTCGTC
AACGAGGACTTCCTCGAAGCAGTATGGGACCAGCTCTGCTACCGGGAGGAAGACCGCGGGCCAGCACCCGAGCTC
CACGTCAACTACACAACCGCCTACGTGTCGACGACGACATCCCCCCAGGAGGCGGCCGAGTTCGCCTCAGGCGGA
TGGGTCTACATCATGCAGGCGACGCCCAACATGCTGCTGCTGCAGGAGAATCTCTTTGACGAGGTTCTAGCTCTG
GGCGGCGTTTACTGGTCTCAGGTAAGGGGCTTCATCCGTGCCGTCGACTGGACGCAGTCTTCCTTCGCCGACATG
GTCCGCGACGGCCGGTATAGCCCTAACCCGGACTTTGACGAGGAGAGATGGGGGGGTCTGACGGTATCGGAGGTT
CCGGAGGGCTGGGATTCTCTTCATCCGGCGCAGTCGGCTCACGAGTTGATGGATTCCGTGGGGGGTTCGGTCGGA
TGGAACGGGAGTTTCCCGCTTCTTCCTCCGGAGACGGTGCGGACGGGAGACGCTGTTATTTCTGTGGATAGACGG
CCGGCGGGGGATGTGCGGGGGACGTCCCGACAGCTTCCGGATGCTTCACCGGGCAACCCCCGGCCGGCTCCGGAT
CACCTACCCGGTACCTCCGGACAGCCCCCGGGGTATCTCCCGGGCGCCTCTCAACAACCGCAGAACCTCCCCGGA
CCCTCCCGACGACCCCTGGAACCGCCGGAGGATCTCCCCGGTTCCTCTCGTCAACCCCCTGATGATCAACAGCGT
GCCTCCCGCCAGCCCCCAAGCAGATGCTCCGCCCCGGATGCATCCCCCAACACCAACTCCTGTCCCCCATCCCGC
AACCGCCAAAGCCTCGAGTACGTCTCCTTGAACAACACGAACGACAGCCTCGAATCCCCATTCAAGAAGCAAAGG
AAAGTAGCACTAGACCTCATCGACGACCGCCTACCCACCACTCTCGCACCCTCCGAAGGCATCATCCCCGAGGAA
ATCCGCCACCGAATCGAGCAGGGCATCCAAACCGAGCAGGACTGCATGTTCGTCCTCAGCCAGCTAAACTCCATG
TTCCCCATGCTCCTCCACTCCAGCATCCTCCGCCGATCATCATCAAATGCCCGCCACTGCGAAGAGCTGTTGGCC
TGGCTGCCTCGCACCTTGCTCTTCCTCATCTGGGAGGGTTCCCGCGGCAGATGTCCTCCCTGCCAGAAGATTGAT
GGGCTGGAGGTTGAGGTGAGTATCGCGGAGGGGGCGCTGGCTGGGACGTGGGATACGGTTTTGGTGGGTGTGGCG
GGGATGACGCCTCATCTGGTGATGGCGACGGGGCCGGAGGCGGGATACAGGGTGAGAAAGAGGTTTGATCTCAAG
AGTGTGTTTGGGGAGAAGGAGGTTTATCTCCGGGATGTGGACAGCGTCAGCCTCATTGATCACGCTCAGGGTAGC
GTCATGGAGCGGGATAAATGGACGCTGCAAGGTAACGTCAACTCCGGGCGCTCTGCTGCTATCTATACTGACGAC
GTGTGTTGTGTAGGCGTCAGGATGTGGGCTCGCTGTGCCGCCTCGTCGCAGATGCTACGCGTTGATCGGTATCGC
GATCTGCGGCTTGGTCTGCGGCATGGGAGGAGCTGGGGGCCGGAAGTGGTTTGGTCTGATAGGATCGAGCTGGGG
GATTGGAGGACTGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail