Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1206
Gene name
LocationContig_147:14105..15782
Strand+
Gene length (bp)1677
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-24 30 392
PF00083 Sugar_tr Sugar (and other) transporter 6.0E-09 51 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 13 514 2.0E-67
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 16 467 2.0E-43
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 15 467 6.0E-40
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 3 467 2.0E-39
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 33 229 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 13 514 2.0E-67
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 16 467 2.0E-43
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 15 467 6.0E-40
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 3 467 2.0E-39
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 33 229 3.0E-11
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 25 175 3.0E-10
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 37 181 4.0E-10
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 32 238 7.0E-10
sp|P0A4K5|PMRA_STRR6 Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pmrA PE=3 SV=1 33 172 4.0E-08
sp|P0A4K4|PMRA_STRPN Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pmrA PE=3 SV=1 33 172 4.0E-08
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 65 186 5.0E-08
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 30 241 1.0E-07
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 65 186 2.0E-07
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 30 183 3.0E-07
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 47 168 3.0E-07
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 25 174 3.0E-07
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 61 186 4.0E-07
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 61 186 4.0E-07
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 61 186 4.0E-07
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 61 186 4.0E-07
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 61 186 4.0E-07
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 52 168 4.0E-07
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 61 186 4.0E-07
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 61 186 5.0E-07
sp|E8XY75|MDTG_RAHSY Multidrug resistance protein MdtG OS=Rahnella sp. (strain Y9602) GN=mdtG PE=3 SV=1 17 112 9.0E-07
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 52 177 1.0E-06
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 53 233 1.0E-06
sp|E3GC98|MDTG_ENTLS Multidrug resistance protein MdtG OS=Enterobacter lignolyticus (strain SCF1) GN=mdtG PE=3 SV=1 33 181 4.0E-06
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 50 177 4.0E-06
sp|D2BX50|MDTG_DICD5 Multidrug resistance protein MdtG OS=Dickeya dadantii (strain Ech586) GN=mdtG PE=3 SV=1 33 126 4.0E-06
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 61 186 5.0E-06
sp|A1JN04|MDTG_YERE8 Multidrug resistance protein MdtG OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtG PE=3 SV=1 33 181 6.0E-06
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 52 167 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 58 80 22
3 90 112 22
4 148 170 22
5 192 214 22
6 292 309 17
7 343 365 22
8 372 394 22
9 404 426 22
10 439 461 22
11 471 493 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1206
MTLTKQARLRNPDDFPKLQLFLLAIVRLAEPIALTSIFPYAWALVKRFKIGNEQDASFYAGLLISSFSLAEALMG
MYWGGLSDRIGRKPVLILGCVGTMFSMVMVGFASNIWIALLGRAVGGLLNGNIGVIQTMVGELVTKPEHEPRAFA
VMPFVWSIGTILGPCIGGTFADPHSSWPQAFPAGGLFERFPYLLPNLLCAALLLISIVLGFVLLEETHPDMQPRV
LLPADTYLTEETPLIETSDAMKRPAVDLRAETYGTMRSINGEAFHEEAAAMRVEKTELAAPTWNKRIVGFIVALS
IFTYHSMTYDHLMPIFFEDDRASTAALVSSKFSGGLGLSLRDVGAIMAVNGAIALFVQAVIFPLAAERMGVYRLF
LVVTVLHPIVYAIVPLLLLVPRYLVFPAIYSCLAIRNLLSITLYPLLLILIKDATPSSSALGKVNGLAASAGAAC
RMIAPPVAGYLYTYGSKMNYTALAWWGSAFIAVIGAVQCFSVPRMQRAETSEESGRLIAETPEDEN*
Coding >Ophun1|1206
ATGACCCTAACGAAGCAGGCCCGTCTCCGCAACCCCGACGACTTTCCCAAGCTTCAGCTTTTCCTGCTCGCCATT
GTTCGTCTTGCTGAGCCCATTGCTCTTACATCCATCTTTCCCTATGCCTGGGCTCTGGTCAAGCGATTCAAAATT
GGCAATGAGCAAGATGCCTCCTTCTACGCGGGTCTCCTCATCTCCTCCTTCTCCCTGGCCGAGGCTCTCATGGGA
ATGTACTGGGGCGGCCTCTCGGATCGCATCGGCCGCAAGCCCGTGTTGATTCTTGGATGTGTGGGCACCATGTTT
AGCATGGTCATGGTTGGCTTTGCCTCCAATATTTGGATCGCTTTGCTTGGACGCGCCGTCGGTGGTCTCCTCAAC
GGCAATATCGGAGTCATCCAGACCATGGTTGGCGAACTCGTCACCAAGCCAGAGCACGAACCTCGCGCCTTTGCT
GTCATGCCATTCGTCTGGAGCATCGGGACCATCCTTGGACCCTGCATCGGTGGCACGTTTGCCGATCCTCACTCG
TCGTGGCCACAGGCTTTCCCCGCTGGTGGCCTCTTTGAGCGCTTCCCATATCTGCTTCCCAACCTGCTGTGTGCC
GCCCTGCTGCTCATCAGCATTGTCCTGGGCTTCGTCCTGCTCGAAGAGACCCATCCCGATATGCAGCCCCGAGTG
CTGCTCCCGGCGGACACGTACTTGACGGAAGAGACGCCGCTGATCGAGACTTCGGATGCCATGAAGCGCCCTGCC
GTCGACCTCCGAGCCGAGACGTACGGAACCATGCGCAGCATCAACGGCGAGGCCTTTCATGAAGAGGCGGCTGCC
ATGCGTGTGGAAAAGACTGAGCTGGCCGCGCCCACCTGGAACAAACGCATCGTTGGCTTCATTGTCGCTCTGTCC
ATCTTCACCTACCATTCCATGACGTACGATCATCTCATGCCCATCTTCTTCGAGGATGATCGTGCGTCGACGGCA
GCCCTTGTCTCGTCCAAGTTCTCCGGTGGGCTGGGACTCTCTCTTCGCGACGTGGGCGCCATCATGGCCGTCAAC
GGTGCCATTGCCCTGTTCGTCCAGGCCGTCATCTTTCCGTTGGCCGCGGAGAGAATGGGCGTGTACCGACTCTTC
CTCGTCGTCACCGTGCTGCACCCGATCGTGTACGCCATTGTCCCTCTGCTCCTGCTCGTCCCCCGATATCTCGTC
TTCCCGGCCATCTACTCTTGTCTCGCCATCCGCAACCTGCTGTCCATTACGCTCTACCCTCTCCTCCTCATCCTC
ATCAAGGACGCTACGCCTTCTTCGAGCGCCCTGGGCAAGGTCAACGGCCTGGCTGCCAGCGCCGGCGCCGCCTGT
CGCATGATTGCTCCTCCGGTCGCCGGTTACCTCTACACCTACGGAAGCAAGATGAACTACACCGCCTTGGCCTGG
TGGGGAAGCGCCTTCATCGCCGTCATCGGAGCGGTCCAGTGCTTTTCTGTCCCTCGCATGCAGAGAGCAGAGACT
TCAGAGGAGAGCGGCAGACTGATTGCTGAAACCCCCGAGGACGAGAATTGA
Transcript >Ophun1|1206
ATGACCCTAACGAAGCAGGCCCGTCTCCGCAACCCCGACGACTTTCCCAAGCTTCAGCTTTTCCTGCTCGCCATT
GTTCGTCTTGCTGAGCCCATTGCTCTTACATCCATCTTTCCCTATGCCTGGGCTCTGGTCAAGCGATTCAAAATT
GGCAATGAGCAAGATGCCTCCTTCTACGCGGGTCTCCTCATCTCCTCCTTCTCCCTGGCCGAGGCTCTCATGGGA
ATGTACTGGGGCGGCCTCTCGGATCGCATCGGCCGCAAGCCCGTGTTGATTCTTGGATGTGTGGGCACCATGTTT
AGCATGGTCATGGTTGGCTTTGCCTCCAATATTTGGATCGCTTTGCTTGGACGCGCCGTCGGTGGTCTCCTCAAC
GGCAATATCGGAGTCATCCAGACCATGGTTGGCGAACTCGTCACCAAGCCAGAGCACGAACCTCGCGCCTTTGCT
GTCATGCCATTCGTCTGGAGCATCGGGACCATCCTTGGACCCTGCATCGGTGGCACGTTTGCCGATCCTCACTCG
TCGTGGCCACAGGCTTTCCCCGCTGGTGGCCTCTTTGAGCGCTTCCCATATCTGCTTCCCAACCTGCTGTGTGCC
GCCCTGCTGCTCATCAGCATTGTCCTGGGCTTCGTCCTGCTCGAAGAGACCCATCCCGATATGCAGCCCCGAGTG
CTGCTCCCGGCGGACACGTACTTGACGGAAGAGACGCCGCTGATCGAGACTTCGGATGCCATGAAGCGCCCTGCC
GTCGACCTCCGAGCCGAGACGTACGGAACCATGCGCAGCATCAACGGCGAGGCCTTTCATGAAGAGGCGGCTGCC
ATGCGTGTGGAAAAGACTGAGCTGGCCGCGCCCACCTGGAACAAACGCATCGTTGGCTTCATTGTCGCTCTGTCC
ATCTTCACCTACCATTCCATGACGTACGATCATCTCATGCCCATCTTCTTCGAGGATGATCGTGCGTCGACGGCA
GCCCTTGTCTCGTCCAAGTTCTCCGGTGGGCTGGGACTCTCTCTTCGCGACGTGGGCGCCATCATGGCCGTCAAC
GGTGCCATTGCCCTGTTCGTCCAGGCCGTCATCTTTCCGTTGGCCGCGGAGAGAATGGGCGTGTACCGACTCTTC
CTCGTCGTCACCGTGCTGCACCCGATCGTGTACGCCATTGTCCCTCTGCTCCTGCTCGTCCCCCGATATCTCGTC
TTCCCGGCCATCTACTCTTGTCTCGCCATCCGCAACCTGCTGTCCATTACGCTCTACCCTCTCCTCCTCATCCTC
ATCAAGGACGCTACGCCTTCTTCGAGCGCCCTGGGCAAGGTCAACGGCCTGGCTGCCAGCGCCGGCGCCGCCTGT
CGCATGATTGCTCCTCCGGTCGCCGGTTACCTCTACACCTACGGAAGCAAGATGAACTACACCGCCTTGGCCTGG
TGGGGAAGCGCCTTCATCGCCGTCATCGGAGCGGTCCAGTGCTTTTCTGTCCCTCGCATGCAGAGAGCAGAGACT
TCAGAGGAGAGCGGCAGACTGATTGCTGAAACCCCCGAGGACGAGAATTGA
Gene >Ophun1|1206
ATGACCCTAACGAAGCAGGCCCGTCTCCGCAACCCCGACGACTTTCCCAAGCTTCAGCTTTTCCTGCTCGGTACG
TCTTTTGTTGTCATGACTCTGGCTTCCCTGTTGTTGTCCCCTGCTGACTCGTTCTCCTTCCAGCCATTGTTCGTC
TTGCTGAGCCCATTGCTCTTACATCCATCTTTCCCTATGCCTGGGCTCTGGTCAAGCGATTCAAAATTGGCAATG
AGCAAGATGCCTCCTTCTACGCGGGTCTCCTCATCTCCTCCTTCTCCCTGGCCGAGGCTCTCATGGGAATGTACT
GGGGCGGCCTCTCGGATCGCATCGGCCGCAAGCCCGTGTTGATTCTTGGATGTGTGGGCACCATGTTTAGCATGG
TCATGGTTGGCTTTGCCTCCAATATTTGGATCGCTTTGCTTGGACGCGCCGTCGGTGGTCTCCTCAACGGCAATA
TCGGAGTCATCCAGACCATGGTTGGCGAACTCGTCACCAAGCCAGAGCACGAACGTGAGTCCACACTGCTTTACC
CGCGAATCAATGTCTTTTTGCTGACTATATCATGCAGCTCGCGCCTTTGCTGTCATGCCATTCGTCTGGAGCATC
GGGACCATCCTTGGACCCTGCATCGGTGGCACGTTTGCCGATCCTCACTCGTCGTGGCCACAGGCTTTCCCCGCT
GGTGGCCTCTTTGAGCGCTTCCCATATCTGCTTCCCAACCTGCTGTGTGCCGCCCTGCTGCTCATCAGCATTGTC
CTGGGCTTCGTCCTGCTCGAAGAGACCCATCCCGATATGCAGCCCCGAGTGCTGCTCCCGGCGGACACGTACTTG
ACGGAAGAGACGCCGCTGATCGAGACTTCGGATGCCATGAAGCGCCCTGCCGTCGACCTCCGAGCCGAGACGTAC
GGAACCATGCGCAGCATCAACGGCGAGGCCTTTCATGAAGAGGCGGCTGCCATGCGTGTGGAAAAGACTGAGCTG
GCCGCGCCCACCTGGAACAAACGCATCGTTGGCTTCATTGTCGCTCTGTCCATCTTCACCTACCATTCCATGACG
TACGATCATCTCATGCCCATCTTCTTCGAGGATGATCGTGCGTCGACGGCAGCCCTTGTCTCGTCCAAGTTCTCC
GGTGGGCTGGGACTCTCTCTTCGCGACGTGGGCGCCATCATGGCCGTCAACGGTGCCATTGCCCTGTTCGTCCAG
GCCGTCATCTTTCCGTTGGCCGCGGAGAGAATGGGCGTGTACCGACTCTTCCTCGTCGTCACCGTGCTGCACCCG
ATCGTGTACGCCATTGTCCCTCTGCTCCTGCTCGTCCCCCGATATCTCGTCTTCCCGGCCATCTACTCTTGTCTC
GCCATCCGCAACCTGCTGTCCATTACGCTCTACCCTCTCCTCCTCATCCTCATCAAGGACGCTACGCCTTCTTCG
AGCGCCCTGGGCAAGGTCAACGGCCTGGCTGCCAGCGCCGGCGCCGCCTGTCGCATGATTGCTCCTCCGGTCGCC
GGTTACCTCTACACCTACGGAAGCAAGATGAACTACACCGCCTTGGCCTGGTGGGGAAGCGCCTTCATCGCCGTC
ATCGGAGCGGTCCAGTGCTTTTCTGTCCCTCGCATGCAGAGAGCAGAGACTTCAGAGGAGAGCGGCAGACTGATT
GCTGAAACCCCCGAGGACGAGAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail