Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1203
Gene name
LocationContig_147:7573..9444
Strand+
Gene length (bp)1871
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.4E-20 116 396
PF07690 MFS_1 Major Facilitator Superfamily 3.9E-09 424 547

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46996|YJQ3_YEAST Uncharacterized membrane protein YJL163C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL163C PE=1 SV=1 18 514 8.0E-25
sp|O13714|YDZ7_SCHPO Uncharacterized membrane protein C14C4.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.07 PE=1 SV=1 73 535 1.0E-13
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 139 528 4.0E-12
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 100 512 3.0E-06
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 110 241 5.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46996|YJQ3_YEAST Uncharacterized membrane protein YJL163C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL163C PE=1 SV=1 18 514 8.0E-25
sp|O13714|YDZ7_SCHPO Uncharacterized membrane protein C14C4.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.07 PE=1 SV=1 73 535 1.0E-13
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 139 528 4.0E-12
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 100 512 3.0E-06
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 110 241 5.0E-06
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 127 274 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 61 80 19
2 120 142 22
3 154 173 19
4 183 205 22
5 218 240 22
6 250 272 22
7 331 353 22
8 373 395 22
9 449 471 22
10 486 508 22
11 515 534 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1203
MASSKSVQPRRLGPEEEEADPSGVQTTETTRLLRADSGSDSGRWTGADDFEGLPWWRKPSVLWLLGPFSLFTLAF
GGTIVPKLNLVLDLVCRRYYADQSTILAVGVDNPMCRTPEVQKDVATFLLVINLVTGGLSAIVAPKLGHLSDRHG
RRKLLALASCGGLLGELITVLAAKFPDTVDYRWLVLGAFFDGMTGSFTAGSILSQSYTSDCTPPSRRAVSIGYIQ
ACLFMGLAFGPLLSGYFVKWTGSLLSMFYVAICCHAFFVLFAGFVMPESLSKKRQLAAREKWKSAQEARGAAGVF
SWLSVVKKSNPFVPLRMLWPTGWGTSTRLRLNLLALAICDAIFLGVAFAIGPVLMLYAESMFHWGNFETSRFVSI
LSLTRVFVLMGLLPLINYIGRVRPAARRQKLFGTAPVEKNAGADGLDIWLLRFALIFEVIACVGYTLARDEDSFV
ASGLVTALGGLGSATTQAAVTKHMPPELVGQMLGAIGMLHALSRIVGPVVFSGLYAATVKTFPQAVFLALGGLFA
FALVTTLVIRPHVHWHEPVEEQHSPQPRGLYSTIVQSLPVDEDQVRLQ*
Coding >Ophun1|1203
ATGGCGTCTTCCAAGTCGGTCCAACCCCGTCGTCTCGGGCCCGAGGAAGAGGAAGCCGATCCGTCCGGAGTTCAG
ACGACCGAAACCACCCGGCTGCTCCGCGCCGATTCGGGGTCGGATTCCGGCCGCTGGACCGGCGCCGATGATTTC
GAGGGCCTGCCGTGGTGGCGCAAGCCTTCGGTCTTGTGGCTGCTCGGTCCCTTTTCGCTCTTCACTCTGGCCTTT
GGCGGTACCATCGTTCCCAAACTAAACTTGGTGCTGGACCTCGTCTGTCGACGGTATTATGCCGATCAGAGCACG
ATTCTGGCCGTCGGCGTCGACAATCCCATGTGCAGAACGCCCGAGGTGCAAAAAGACGTCGCAACTTTTCTGCTC
GTCATCAATCTCGTCACGGGTGGCTTGAGCGCCATCGTCGCCCCTAAACTTGGCCACCTTTCCGACCGTCATGGC
CGCCGAAAGCTGCTGGCCTTGGCGTCGTGTGGCGGTCTGCTGGGCGAGCTCATCACCGTCCTGGCCGCCAAGTTT
CCCGACACCGTCGACTACCGCTGGCTCGTTCTCGGTGCCTTCTTTGACGGCATGACCGGCTCCTTTACCGCTGGC
AGCATCCTCAGCCAGTCGTATACGAGCGACTGTACGCCCCCGTCCAGGCGCGCCGTGTCCATCGGATACATCCAG
GCCTGCCTCTTCATGGGCCTGGCCTTTGGACCTCTGCTGTCCGGCTATTTCGTCAAGTGGACGGGCAGTCTCTTG
TCCATGTTCTATGTCGCCATCTGCTGTCACGCCTTCTTCGTGCTCTTCGCCGGCTTCGTCATGCCCGAGTCTCTG
TCTAAAAAGAGGCAACTAGCGGCCCGAGAAAAATGGAAGAGCGCACAGGAGGCTCGAGGCGCGGCCGGTGTCTTC
TCCTGGCTGTCCGTCGTCAAGAAGTCGAACCCGTTTGTTCCCCTGCGGATGCTGTGGCCCACCGGTTGGGGGACG
TCGACGCGGCTGCGCCTCAACCTGCTGGCGTTGGCCATCTGCGACGCCATCTTCCTCGGAGTCGCCTTTGCCATC
GGGCCCGTCCTGATGTTGTACGCCGAGTCCATGTTTCACTGGGGCAACTTTGAGACGTCGCGCTTCGTCTCTATC
CTGTCATTGACCCGCGTCTTCGTCCTCATGGGGCTGCTTCCGCTCATCAATTACATCGGACGTGTGCGGCCCGCG
GCCCGGCGGCAGAAGCTGTTCGGCACGGCTCCGGTGGAGAAGAACGCTGGAGCGGACGGGCTCGACATCTGGCTC
CTCCGCTTCGCCCTGATATTTGAGGTGATTGCTTGTGTGGGCTACACGTTAGCCAGAGATGAGGACTCGTTCGTG
GCAAGCGGCCTGGTGACAGCCCTGGGCGGCCTCGGGAGCGCCACGACTCAGGCGGCCGTAACTAAGCACATGCCG
CCGGAGCTGGTGGGCCAGATGCTGGGCGCCATCGGCATGCTGCACGCTCTGTCGAGGATTGTCGGCCCAGTCGTC
TTCAGTGGACTGTACGCCGCGACCGTCAAGACGTTTCCGCAGGCCGTCTTCCTCGCCCTCGGCGGCCTATTTGCC
TTTGCTCTGGTGACCACTCTGGTCATCAGACCGCATGTCCACTGGCACGAACCCGTCGAGGAGCAGCACAGCCCG
CAACCCCGTGGGCTGTATAGCACCATCGTGCAATCGCTGCCCGTCGACGAGGATCAGGTGCGCTTACAGTAA
Transcript >Ophun1|1203
ATGGCGTCTTCCAAGTCGGTCCAACCCCGTCGTCTCGGGCCCGAGGAAGAGGAAGCCGATCCGTCCGGAGTTCAG
ACGACCGAAACCACCCGGCTGCTCCGCGCCGATTCGGGGTCGGATTCCGGCCGCTGGACCGGCGCCGATGATTTC
GAGGGCCTGCCGTGGTGGCGCAAGCCTTCGGTCTTGTGGCTGCTCGGTCCCTTTTCGCTCTTCACTCTGGCCTTT
GGCGGTACCATCGTTCCCAAACTAAACTTGGTGCTGGACCTCGTCTGTCGACGGTATTATGCCGATCAGAGCACG
ATTCTGGCCGTCGGCGTCGACAATCCCATGTGCAGAACGCCCGAGGTGCAAAAAGACGTCGCAACTTTTCTGCTC
GTCATCAATCTCGTCACGGGTGGCTTGAGCGCCATCGTCGCCCCTAAACTTGGCCACCTTTCCGACCGTCATGGC
CGCCGAAAGCTGCTGGCCTTGGCGTCGTGTGGCGGTCTGCTGGGCGAGCTCATCACCGTCCTGGCCGCCAAGTTT
CCCGACACCGTCGACTACCGCTGGCTCGTTCTCGGTGCCTTCTTTGACGGCATGACCGGCTCCTTTACCGCTGGC
AGCATCCTCAGCCAGTCGTATACGAGCGACTGTACGCCCCCGTCCAGGCGCGCCGTGTCCATCGGATACATCCAG
GCCTGCCTCTTCATGGGCCTGGCCTTTGGACCTCTGCTGTCCGGCTATTTCGTCAAGTGGACGGGCAGTCTCTTG
TCCATGTTCTATGTCGCCATCTGCTGTCACGCCTTCTTCGTGCTCTTCGCCGGCTTCGTCATGCCCGAGTCTCTG
TCTAAAAAGAGGCAACTAGCGGCCCGAGAAAAATGGAAGAGCGCACAGGAGGCTCGAGGCGCGGCCGGTGTCTTC
TCCTGGCTGTCCGTCGTCAAGAAGTCGAACCCGTTTGTTCCCCTGCGGATGCTGTGGCCCACCGGTTGGGGGACG
TCGACGCGGCTGCGCCTCAACCTGCTGGCGTTGGCCATCTGCGACGCCATCTTCCTCGGAGTCGCCTTTGCCATC
GGGCCCGTCCTGATGTTGTACGCCGAGTCCATGTTTCACTGGGGCAACTTTGAGACGTCGCGCTTCGTCTCTATC
CTGTCATTGACCCGCGTCTTCGTCCTCATGGGGCTGCTTCCGCTCATCAATTACATCGGACGTGTGCGGCCCGCG
GCCCGGCGGCAGAAGCTGTTCGGCACGGCTCCGGTGGAGAAGAACGCTGGAGCGGACGGGCTCGACATCTGGCTC
CTCCGCTTCGCCCTGATATTTGAGGTGATTGCTTGTGTGGGCTACACGTTAGCCAGAGATGAGGACTCGTTCGTG
GCAAGCGGCCTGGTGACAGCCCTGGGCGGCCTCGGGAGCGCCACGACTCAGGCGGCCGTAACTAAGCACATGCCG
CCGGAGCTGGTGGGCCAGATGCTGGGCGCCATCGGCATGCTGCACGCTCTGTCGAGGATTGTCGGCCCAGTCGTC
TTCAGTGGACTGTACGCCGCGACCGTCAAGACGTTTCCGCAGGCCGTCTTCCTCGCCCTCGGCGGCCTATTTGCC
TTTGCTCTGGTGACCACTCTGGTCATCAGACCGCATGTCCACTGGCACGAACCCGTCGAGGAGCAGCACAGCCCG
CAACCCCGTGGGCTGTATAGCACCATCGTGCAATCGCTGCCCGTCGACGAGGATCAGGTGCGCTTACAGTAA
Gene >Ophun1|1203
ATGGCGTCTTCCAAGTCGGTCCAACCCCGTCGTCTCGGGCCCGAGGAAGAGGAAGCCGATCCGTCCGGAGTTCAG
ACGACCGAAACCACCCGGCTGCTCCGCGCCGATTCGGGGTCGGATTCCGGCCGCTGGACCGGCGCCGATGATTTC
GAGGGCCTGCCGTGGTGGCGCAAGCCTTCGGTTTGTCCTTCGCTGGCGCTCGAGCTTCTTATAGGCTGATGCACG
AGGCCAGGTCTTGTGGCTGCTCGGTCCCTTTTCGCTCTTCACTCTGGCCTTTGGCGGTACCATCGTTCCCAAACT
AAACTTGTGAGCCTTCTTCTGCGCCAAATCTGGCCGTTCTGACTGGTTGAAAGGGTGCTGGACCTCGTCTGTCGA
CGGTATTATGCCGATCAGAGCACGATTCTGGCCGTCGGCGTCGACAATCCCATGTGCAGAACGCCCGAGGTGCAA
AAAGACGTCGCAACTTTTCTGCTCGTCATCAATCTCGTCACGGGTGGCTTGAGCGCCATCGTCGCCCCTAAACTT
GGCCACCTTTCCGACCGTCATGGCCGCCGAAAGCTGCTGGCCTTGGCGTCGTGTGGCGGTCTGCTGGGCGAGCTC
ATCACCGTCCTGGCCGCCAAGTTTCCCGACACCGTCGACTACCGCTGGCTCGTTCTCGGTGCCTTCTTTGACGGC
ATGACCGGCTCCTTTACCGCTGGCAGCATCCTCAGCCAGTCGTATACGAGCGACTGTACGCCCCCGTCCAGGCGC
GCCGTGTCCATCGGATACATCCAGGCCTGCCTCTTCATGGGCCTGGCCTTTGGACCTCTGCTGTCCGGCTATTTC
GTCAAGTGGACGGGCAGTCTCTTGTCCATGTTCTATGTCGCCATCTGCTGTCACGCCTTCTTCGTGCTCTTCGCC
GGCTTCGTCATGCCCGAGTCTCTGTCTAAAAAGAGGCAACTAGCGGCCCGAGAAAAATGGAAGAGCGCACAGGAG
GCTCGAGGCGCGGCCGGTGTCTTCTCCTGGCTGTCCGTCGTCAAGAAGTCGAACCCGTTTGTTCCCCTGCGGATG
CTGTGGCCCACCGGTTGGGGGACGTCGACGCGGCTGCGCCTCAACCTGCTGGCGTTGGCCATCTGCGACGCCATC
TTCCTCGGAGTCGCCTTTGCCATCGGGCCCGTCCTGATGTTGTACGCCGAGTCCATGTTTCACTGGGGCAACTTT
GAGACGTCGCGCTTCGTCTCTATCCTGTCATTGACCCGCGTCTTCGTCCTCATGGGGCTGCTTCCGCTCATCAAT
TACATCGGACGTGTGCGGCCCGCGGCCCGGCGGCAGAAGCTGTTCGGCACGGCTCCGGTGGAGAAGAACGCTGGA
GCGGACGGGCTCGACATCTGGCTCCTCCGCTTCGCCCTGATATTTGAGGTGATTGCTTGTGTGGGCTACACGTTA
GCCAGAGATGAGGACTCGTTCGTGGCAAGCGGCCTGGTGACAGCCCTGGGCGGCCTCGGGAGCGCCACGACTCAG
GCGGCCGTAACTAAGCACATGCCGCCGGAGCTGGTGGGCCAGATGCTGGGCGCCATCGGCATGCTGCACGCTCTG
TCGAGGATTGTCGGCCCAGTCGTCTTCAGTGGACTGTACGCCGCGACCGTCAAGACGTTTCCGCAGGCCGTCTTC
CTCGCCCTCGGCGGCCTATTTGCCTTTGCTCTGGTGACCACTCTGGTCATCAGACCGCATGGTATGTGCTCCCGG
ATCCTTACCTGTGTGATGCTGGCTGACTCTCGACAGTCCACTGGCACGAACCCGTCGAGGAGCAGCACAGCCCGC
AACCCCGTGGGCTGTATAGCACCATCGTGCAATCGCTGCCCGTCGACGAGGATCAGGTGCGCTTACAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail