Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1195
Gene name
LocationContig_146:18767..20226
Strand-
Gene length (bp)1459
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.5E-19 26 270
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 5.1E-08 80 253

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q45FA5|SRPK_PHYPO Serine/threonine-protein kinase SRPK OS=Physarum polycephalum PE=1 SV=1 24 282 8.0E-19
sp|P51568|AFC3_ARATH Serine/threonine-protein kinase AFC3 OS=Arabidopsis thaliana GN=AFC3 PE=2 SV=2 77 282 3.0E-14
sp|P51566|AFC1_ARATH Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2 77 282 4.0E-13
sp|P51567|AFC2_ARATH Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1 77 282 3.0E-12
sp|P78362|SRPK2_HUMAN SRSF protein kinase 2 OS=Homo sapiens GN=SRPK2 PE=1 SV=3 24 148 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q45FA5|SRPK_PHYPO Serine/threonine-protein kinase SRPK OS=Physarum polycephalum PE=1 SV=1 24 282 8.0E-19
sp|P51568|AFC3_ARATH Serine/threonine-protein kinase AFC3 OS=Arabidopsis thaliana GN=AFC3 PE=2 SV=2 77 282 3.0E-14
sp|P51566|AFC1_ARATH Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2 77 282 4.0E-13
sp|P51567|AFC2_ARATH Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1 77 282 3.0E-12
sp|P78362|SRPK2_HUMAN SRSF protein kinase 2 OS=Homo sapiens GN=SRPK2 PE=1 SV=3 24 148 1.0E-09
sp|O54781|SRPK2_MOUSE SRSF protein kinase 2 OS=Mus musculus GN=Srpk2 PE=1 SV=2 24 148 1.0E-09
sp|Q4R6S5|DYRK3_MACFA Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Macaca fascicularis GN=DYRK3 PE=2 SV=1 26 289 2.0E-09
sp|O43781|DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Homo sapiens GN=DYRK3 PE=2 SV=3 26 289 2.0E-09
sp|Q5RD27|SRPK1_PONAB SRSF protein kinase 1 OS=Pongo abelii GN=SRPK1 PE=2 SV=2 24 148 1.0E-08
sp|Q96SB4|SRPK1_HUMAN SRSF protein kinase 1 OS=Homo sapiens GN=SRPK1 PE=1 SV=2 24 148 1.0E-08
sp|Q54UA9|CLKA_DICDI Probable serine/threonine-protein kinase clkA OS=Dictyostelium discoideum GN=clkA PE=3 SV=1 28 276 2.0E-08
sp|O70551|SRPK1_MOUSE SRSF protein kinase 1 OS=Mus musculus GN=Srpk1 PE=1 SV=2 24 148 2.0E-08
sp|Q61IS6|SPK1_CAEBR Serine/threonine-protein kinase spk-1 OS=Caenorhabditis briggsae GN=spk-1 PE=3 SV=2 25 146 3.0E-08
sp|Q03563|SPK1_CAEEL Serine/threonine-protein kinase spk-1 OS=Caenorhabditis elegans GN=spk-1 PE=2 SV=3 25 146 4.0E-08
sp|Q86A12|SKY1_DICDI Probable serine/threonine-protein kinase sky1 OS=Dictyostelium discoideum GN=sky1 PE=3 SV=1 24 173 7.0E-08
sp|Q10156|LKH1_SCHPO Dual specificity protein kinase lkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lkh1 PE=1 SV=3 98 301 1.0E-07
sp|B8Y466|SRPK3_PIG SRSF protein kinase 3 OS=Sus scrofa GN=SRPK3 PE=2 SV=1 25 148 2.0E-07
sp|O35493|CLK4_MOUSE Dual specificity protein kinase CLK4 OS=Mus musculus GN=Clk4 PE=1 SV=1 119 289 3.0E-07
sp|Q9UPE1|SRPK3_HUMAN SRSF protein kinase 3 OS=Homo sapiens GN=SRPK3 PE=1 SV=2 25 148 3.0E-07
sp|Q9Z0G2|SRPK3_MOUSE SRSF protein kinase 3 OS=Mus musculus GN=Srpk3 PE=1 SV=1 25 148 3.0E-07
sp|Q9HAZ1|CLK4_HUMAN Dual specificity protein kinase CLK4 OS=Homo sapiens GN=CLK4 PE=1 SV=1 119 289 3.0E-07
sp|P36616|DSK1_SCHPO Protein kinase dsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsk1 PE=3 SV=2 24 147 7.0E-07
sp|Q03656|SKY1_YEAST Serine/threonine-protein kinase SKY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKY1 PE=1 SV=1 66 157 1.0E-06
sp|P49759|CLK1_HUMAN Dual specificity protein kinase CLK1 OS=Homo sapiens GN=CLK1 PE=1 SV=2 22 300 2.0E-06
sp|O35491|CLK2_MOUSE Dual specificity protein kinase CLK2 OS=Mus musculus GN=Clk2 PE=1 SV=2 119 289 2.0E-06
sp|P49760|CLK2_HUMAN Dual specificity protein kinase CLK2 OS=Homo sapiens GN=CLK2 PE=1 SV=1 119 289 2.0E-06
sp|P32350|KNS1_YEAST Dual specificity protein kinase KNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KNS1 PE=1 SV=2 27 282 4.0E-06
sp|Q3SX21|CLK3_BOVIN Dual specificity protein kinase CLK3 OS=Bos taurus GN=CLK3 PE=2 SV=1 119 289 4.0E-06
sp|Q63117|CLK3_RAT Dual specificity protein kinase CLK3 OS=Rattus norvegicus GN=Clk3 PE=1 SV=2 119 289 4.0E-06
sp|O35492|CLK3_MOUSE Dual specificity protein kinase CLK3 OS=Mus musculus GN=Clk3 PE=1 SV=2 119 289 8.0E-06
sp|P49761|CLK3_HUMAN Dual specificity protein kinase CLK3 OS=Homo sapiens GN=CLK3 PE=1 SV=3 119 289 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1195
MHIPLEEEQVPGYDSSRYYPANPGERYVALKICNTGQDSEYELDMNKHLISANPQHRGHGALSTAIECFTVDSPR
GQNHVVLVFEPLRDTLRRIRHRLSLRNYVTLAPLGLFKTYLEIVAEGLDYMHTQCHVVHTDLKLENIMMTFEDMS
TIDALIEEQKTMPMARKYVKDRTVYRSHNNFGPVDSNLLHIIPQITDFDLARRVDKGVPLIEPIQANECQAPEVL
FGTGWSYSADMWNFGAMIWEFLGGESLFIQKKCFSQAQHLANIIALHGPPPPELIQREREMRHLRFPPSNSPGAG
L*
Coding >Ophun1|1195
ATGCACATACCTCTGGAAGAGGAACAGGTCCCTGGCTACGACTCTAGTCGTTATTATCCTGCAAATCCTGGCGAA
CGCTACGTCGCCCTCAAAATTTGCAACACCGGGCAGGACTCAGAGTACGAGCTGGATATGAACAAGCACCTCATA
TCAGCAAACCCCCAGCATCGCGGACATGGGGCTCTATCGACGGCCATCGAATGCTTCACGGTTGACTCGCCTAGA
GGACAAAACCACGTTGTACTTGTATTCGAGCCGTTGAGAGATACCCTGAGGCGCATTAGGCACCGTCTTTCGCTC
CGAAATTACGTCACTTTGGCTCCTCTGGGTCTCTTCAAGACCTATCTTGAGATTGTAGCGGAAGGGTTAGACTAC
ATGCATACCCAGTGTCACGTTGTTCATACAGACCTCAAATTGGAAAATATCATGATGACTTTTGAGGACATGTCT
ACCATTGACGCACTGATCGAGGAGCAGAAAACCATGCCCATGGCTAGGAAGTACGTTAAAGATCGTACTGTTTAC
CGCAGCCACAACAACTTTGGGCCTGTGGACAGCAACCTGTTACACATAATACCCCAAATAACCGACTTCGACCTG
GCACGGCGTGTGGACAAGGGAGTACCACTCATAGAGCCAATTCAGGCCAACGAGTGCCAAGCACCTGAGGTTTTG
TTTGGTACTGGCTGGTCCTACAGTGCTGACATGTGGAACTTTGGAGCCATGATCTGGGAATTTTTGGGCGGAGAG
TCGCTATTCATACAGAAGAAATGCTTCTCGCAAGCCCAGCATCTTGCAAACATCATCGCTCTCCACGGTCCGCCC
CCTCCTGAGCTGATCCAGCGGGAACGAGAAATGAGACATCTCAGATTTCCACCGAGCAACAGCCCGGGAGCTGGT
CTCTGA
Transcript >Ophun1|1195
ATGCACATACCTCTGGAAGAGGAACAGGTCCCTGGCTACGACTCTAGTCGTTATTATCCTGCAAATCCTGGCGAA
CGCTACGTCGCCCTCAAAATTTGCAACACCGGGCAGGACTCAGAGTACGAGCTGGATATGAACAAGCACCTCATA
TCAGCAAACCCCCAGCATCGCGGACATGGGGCTCTATCGACGGCCATCGAATGCTTCACGGTTGACTCGCCTAGA
GGACAAAACCACGTTGTACTTGTATTCGAGCCGTTGAGAGATACCCTGAGGCGCATTAGGCACCGTCTTTCGCTC
CGAAATTACGTCACTTTGGCTCCTCTGGGTCTCTTCAAGACCTATCTTGAGATTGTAGCGGAAGGGTTAGACTAC
ATGCATACCCAGTGTCACGTTGTTCATACAGACCTCAAATTGGAAAATATCATGATGACTTTTGAGGACATGTCT
ACCATTGACGCACTGATCGAGGAGCAGAAAACCATGCCCATGGCTAGGAAGTACGTTAAAGATCGTACTGTTTAC
CGCAGCCACAACAACTTTGGGCCTGTGGACAGCAACCTGTTACACATAATACCCCAAATAACCGACTTCGACCTG
GCACGGCGTGTGGACAAGGGAGTACCACTCATAGAGCCAATTCAGGCCAACGAGTGCCAAGCACCTGAGGTTTTG
TTTGGTACTGGCTGGTCCTACAGTGCTGACATGTGGAACTTTGGAGCCATGATCTGGGAATTTTTGGGCGGAGAG
TCGCTATTCATACAGAAGAAATGCTTCTCGCAAGCCCAGCATCTTGCAAACATCATCGCTCTCCACGGTCCGCCC
CCTCCTGAGCTGATCCAGCGGGAACGAGAAATGAGACATCTCAGATTTCCACCGAGCAACAGCCCGGGAGCTGGT
CTCTGA
Gene >Ophun1|1195
ATGCACATACCTCTGGAAGAGGAACAGGTCCCTGGCTACGACTCTAGTCGTTATTATCCTGCAAATCCTGGCGAA
GTGCTTAACGACAAGTATCGACTAGAGTTGAAGCTTGGCTGGGGGGGGTCATCCACTGTCTGGCTCGCTCACGAC
GTGAAAAGGTATCTGATTTTCGACGACTGAGCAATAGTTTCTGCTTGCGAGAAAGGCTGACACTCCTTCAGAAGC
TCTGACGCCCAGCCAAAGCGCTACGTCGCCCTCAAAATTTGCAACACCGGGCAGGACTCAGAGTACGAGCTGGAT
ATGAACAAGCACCTCATATCAGCAAACCCCCAGCATCGCGGACATGGGGCTCTATCGACGGCCATCGAATGCTTC
ACGGTTGACTCGCCTAGAGGACAAAACCACGTTGTACTTGTATTCGAGCCGTTGAGAGATACCCTGAGGCGCATT
AGGCACCGTCTTTCGCTCCGAAATTACGTCACTTTGGCTCCTCTGGGTCTCTTCAAGACCTATCTTGAGATTGTA
GCGGAAGGGTTAGACTACATGCATACCCAGTGTCACGTTGTTCATACAGGTGAGCTCTACCCCTTGACAGGATCC
AATGGAAGCCATCGTTTAATGCTCCCCTGTAGACCTCAAATTGGAAAATATCATGATGACTTTTGAGGACATGTC
TACCATTGACGCACTGATCGAGGAGCAGAAAACCATGCCCATGGCTAGGAAGTACGTTAAAGATCGTACTGTTTA
CCGCAGCCACAACAACTTTGGGCCTGTGGACAGCAACCTGTTACACATAATACCCCAAATAACCGACTTCGACCT
GGCACGGCGTGTGGACAAGGGAGTACCACTCATAGAGCCAATTCAGGCCAACGAGTGCCAAGCACCTGAGGTTTT
GTTTGGTACTGGCTGGTCCTACAGTGCTGACATGTGGAACTTTGGAGCCATGGTCAGCTCTCTGCCCTCGATACT
CTCCTTGAACTTGACTGACCCTCGCAGATCTGGGAATTTTTGGGCGGAGAGTCGCTATTCATACAGAAGAAATGC
TTCTCGCAAGCCCAGCATCTTGCAAACATCATCGCTCTCCACGGTCCGCCCCCTCCTGAGCTGATCCAGCGGGAA
CGAGAAATGAGACATCTCAGATTTCCACGTAAGCTCTGGAACTCGGAGGGGAAGCTTTGCTCTACTGCTATTGAA
TATTTCGGAGGGCCTTTTTTCGCCGACGATGGTGTGTGCAACTTTCTTACACAACCTGATACTCACCTTGACTGA
CCTGTATTGTGATTGAAGGCACTTTCTTGTACAATGATTTGATCCCCAAGGATCGAAGTCTCGAGAATGAACTGC
CCAAGTGTGTAGTCAAAGAGGGACAAGTAGATGCCTTCCTCGCCTTTATGAGGAAAATGCTTTGCTGGCTGCCCG
AAAAGCGAGCAACAGCCCGGGAGCTGGTCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail