Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1189
Gene name
LocationContig_146:2534..8139
Strand-
Gene length (bp)5605
Transcript length (bp)5502
Coding sequence length (bp)5502
Protein length (aa) 1834

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12830 Nipped-B_C Sister chromatid cohesion C-terminus 5.0E-46 1429 1617
PF12765 Cohesin_HEAT HEAT repeat associated with sister chromatid cohesion 3.2E-06 953 994

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00333|NPBL_COPC7 Protein rad9 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=rad9 PE=2 SV=2 438 1695 5.0E-78
sp|Q09725|MIS4_SCHPO Sister chromatid cohesion protein mis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis4 PE=1 SV=2 512 1626 2.0E-58
sp|Q6KC79|NIPBL_HUMAN Nipped-B-like protein OS=Homo sapiens GN=NIPBL PE=1 SV=2 377 1630 9.0E-47
sp|Q6KCD5|NIPBL_MOUSE Nipped-B-like protein OS=Mus musculus GN=Nipbl PE=1 SV=1 377 1630 2.0E-46
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 432 1634 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00333|NPBL_COPC7 Protein rad9 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=rad9 PE=2 SV=2 438 1695 5.0E-78
sp|Q09725|MIS4_SCHPO Sister chromatid cohesion protein mis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis4 PE=1 SV=2 512 1626 2.0E-58
sp|Q6KC79|NIPBL_HUMAN Nipped-B-like protein OS=Homo sapiens GN=NIPBL PE=1 SV=2 377 1630 9.0E-47
sp|Q6KCD5|NIPBL_MOUSE Nipped-B-like protein OS=Mus musculus GN=Nipbl PE=1 SV=1 377 1630 2.0E-46
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 432 1634 4.0E-39
sp|F5HSE3|NIPLA_DANRE Nipped-B-like protein A OS=Danio rerio GN=nipbla PE=2 SV=1 691 1636 1.0E-35
sp|Q95XZ5|NPBL_CAEEL Nipped-B-like protein pqn-85 OS=Caenorhabditis elegans GN=pqn-85 PE=3 SV=2 438 1589 1.0E-28
sp|Q750S2|SCC2_ASHGO Sister chromatid cohesion protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SCC2 PE=1 SV=1 518 1492 6.0E-24
sp|Q7PLI2|NIPB_DROME Nipped-B protein OS=Drosophila melanogaster GN=Nipped-B PE=1 SV=3 536 1559 5.0E-16
sp|Q04002|SCC2_YEAST Sister chromatid cohesion protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCC2 PE=1 SV=1 910 1524 2.0E-14
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1552
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4410
Ophiocordyceps australis map64 (Brazil) OphauB2|1213
Ophiocordyceps camponoti-floridani Ophcf2|02766
Ophiocordyceps camponoti-rufipedis Ophun1|1189 (this protein)
Ophiocordyceps kimflemingae Ophio5|2897
Ophiocordyceps subramaniannii Hirsu2|11275

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1189
MLPRAPNGPENGVHALQPPSQPHPAISRPFTLQESLPYSPQTSMTPLLPDVIPDPTLGSGSPALPISGLFPRDEF
DRVNAEALNHPQGSRALKQAADYVLHDLKPSQRTQYKFSAIPSGPPGMTPGKSLSQGLSPMTRNVYDRVGSFFKS
TKANVTGSKTNGDSHEPLKSGKQSPSLSSKAPPNMQNRRSENPESHRSPSFRIEVAIPAKKAFDPSSYIEVASSA
HPDPIPRSVSQELPAKAKPSAFNDDATTFKEPSPAGGKNLAFSIELPKANIKKEEYVEVCEVPDAPASLSTRRSG
THDVAPNQGVTVTSLDQRQRSEVALEAFDALFRSISGAVGSAYAMEPGTEHIVTMTADQEPVMTSATQQKLHGAI
QKIIDLRCFDSVALETLLHIVKLCEPTLRQVESLEFRVDESWDEGAVESWVQQLSELETALKAARTCLRLLSGGR
EDKQLYSESTIQRCVDLFKSVTEDLVIPLVELRPSSGLFKLVQKHKKAVSSTFVCCQKLFALLAELVTKIELSES
VINTLEYTSSKLIFVENAYFEKDSAIGPQRFDGIRSVAMDMLCQIFLIKPEQRQGIIDDILTSLEKLPVGKQSSR
QFKLSDGGSIQPVSALIMRLVQASSGRVNVDDGSGRAAILQRINGTDAGEGEAPPAKKSQSPWTVTTELRGAQQH
AVAIQELGASAAPLAEAASRNASYVINFIVKRAIGSTKTGDTPYRNLLDLFVDDFTTCLDSPDWPSAELLLRLLM
FMMVQLFEAGKTAAPAKNMALELLGSMSAAISRLRSHVKKTAGSFEGSDTSELSQYLSELAILVLEHKSQVEHIS
TWTGPYRVSLEYVQERCVEDPHLAAAASYMVTNWATKLHIAYDNAQESDDERDREFGRMAYRLRMMVEDRKWLSG
QYTFKAVSASQARFAYSIILLQSPLFEAFGKIVNILLGSMASDQATVRSKSLKSIHQVLETDPSILDGDSTVIQL
ILDCASDSSTQVRDSALGLLGNCIGMRRALELSLTPRIIERFQDAGVGVRKRAMKLARDIYLRNRSKTLRSAIAN
GLLRRVQDPDEGVRDLSRQMIEEVWFAPFYSNENTAAFETSLGEHVALIIQTVKTGTVTEVLDKVFQTVLRPQNR
SLEGPFSVCSRLVRTMFGMIDNPDSEDTTVPSGRDALQVLTIFAKADPKLFNFEQIRLLKPQLASFSGREELAAF
RAVTVIYKRVLPQLPMVHAEFLAEVRLQLLKAIGKIFSRVALDDLIACTQAVCELLKDFAPLANLVASSLLGIQK
LGKGKLDKRGLGQLCAYAIIVGSVGKHSDLDQQLQVFRDRFPQWKGDSVPRLIVDMLAPFASPTQTLEARKAAIE
AIGLVCQSWPRNYVLAKVYTAFQQVFQDQVQALEALVLRSFKEFLMTEEKRSEAGIEAGSGDKKKELTVMGGTNF
DDVASATTQRFLKDMTRIALGSQDDHAFLAMEVLSSINRQGLTHPKETGLTLMTLETSANRKIAELAYMEHRALH
EKHETVLEREYIKAVQSAYGYQRDVVQDCRGATKEPLQSKLHLLMEVLKISKMKNRQRFLEKLCGQIDFDLAKLE
ETTPEGMPEHVGFARFVIESVAFIEFQTAGEVQTTVNALEKIVASTGATVAQAIESEVFNLRMDADEPTNDSMVT
TTEATAVTVRPKIESRRLRQLAAASVMLLLVWETRTHIRKLYGMGTHRHDSKAKALAKDLNKTPTKVQGVHGERL
WDELTNHMGGLDSEERMAIKCRELVELMTVDKEFQVADKDSGDDDMADGPATPSDGDDGEEAPERGRKRKGAATP
GGRKKRARSGSQPRKRGRPRKQSEEADMNGDWI*
Coding >Ophun1|1189
ATGCTGCCACGCGCACCAAACGGTCCCGAGAATGGGGTCCATGCGCTTCAGCCTCCTTCACAACCTCATCCCGCC
ATCTCGCGACCCTTTACGCTGCAAGAGTCGCTGCCTTACTCGCCCCAGACGTCGATGACGCCCCTTCTCCCTGAC
GTCATTCCCGATCCAACCTTGGGATCCGGTTCGCCCGCTCTGCCCATCTCGGGCCTGTTCCCGCGAGACGAGTTC
GACAGGGTCAACGCCGAGGCCCTGAATCACCCGCAAGGTTCGAGGGCCTTGAAGCAGGCTGCAGACTATGTGCTG
CACGACCTGAAGCCGTCCCAAAGAACACAATACAAATTCTCGGCCATACCCTCAGGACCCCCTGGCATGACCCCC
GGGAAAAGCCTTTCTCAGGGTCTCTCGCCCATGACCAGAAACGTTTACGACCGGGTGGGCAGTTTCTTCAAGTCG
ACCAAAGCCAACGTCACAGGTTCGAAGACGAATGGCGACTCCCATGAGCCGCTGAAATCGGGCAAACAATCTCCC
TCGCTCAGCTCCAAAGCTCCTCCCAATATGCAAAACCGACGATCAGAGAATCCCGAGTCACATAGATCTCCCTCC
TTTAGGATAGAGGTGGCTATCCCTGCGAAAAAGGCCTTTGACCCGAGTTCTTATATCGAAGTCGCGAGCTCCGCC
CACCCGGACCCGATCCCACGGTCGGTGTCTCAGGAGCTTCCCGCAAAGGCCAAGCCTTCTGCTTTCAACGACGAC
GCCACAACCTTCAAAGAGCCATCCCCTGCGGGCGGAAAGAACCTGGCCTTTAGCATAGAGCTGCCCAAGGCCAAT
ATCAAGAAGGAAGAGTACGTCGAGGTTTGCGAGGTCCCGGACGCTCCCGCAAGCCTCTCGACCCGGCGATCGGGA
ACACATGACGTCGCTCCTAACCAGGGCGTCACCGTTACCAGCCTTGATCAGCGTCAGAGGAGCGAGGTGGCTTTG
GAAGCCTTTGACGCGCTTTTCCGATCCATTAGCGGTGCGGTTGGAAGCGCTTACGCCATGGAACCAGGAACAGAG
CACATCGTGACCATGACGGCGGATCAGGAGCCCGTCATGACCTCGGCCACGCAGCAAAAGCTGCACGGCGCCATT
CAGAAGATTATCGATCTGAGGTGCTTCGATAGTGTGGCTCTGGAAACTTTGCTACACATCGTCAAGCTGTGCGAA
CCAACGCTGAGACAAGTCGAAAGCCTGGAGTTTCGCGTCGACGAGAGCTGGGATGAAGGGGCCGTCGAGTCTTGG
GTCCAGCAGCTATCTGAGCTGGAAACGGCGTTGAAAGCTGCGCGAACTTGCTTGCGCTTGCTCTCCGGAGGTCGC
GAAGACAAGCAACTGTACTCGGAGTCGACTATTCAACGGTGCGTTGATCTCTTCAAGTCGGTCACTGAAGACCTG
GTCATACCCTTGGTCGAACTGCGACCGTCTTCCGGCCTTTTCAAGTTGGTGCAGAAACACAAAAAGGCCGTGTCG
TCGACCTTTGTCTGTTGCCAGAAGCTGTTTGCTCTGCTTGCGGAGCTCGTAACCAAGATTGAGCTCTCCGAGTCA
GTCATCAACACTCTCGAGTACACGTCATCCAAACTCATCTTCGTGGAGAATGCCTACTTTGAGAAGGACTCTGCC
ATCGGTCCTCAGAGGTTTGACGGGATTCGATCCGTTGCCATGGATATGCTCTGCCAGATCTTTCTCATCAAGCCC
GAGCAGAGGCAGGGCATCATCGACGACATACTCACCTCGCTCGAGAAGCTCCCCGTCGGAAAGCAGAGCTCGAGG
CAGTTCAAGCTCTCTGACGGCGGAAGCATTCAGCCCGTCTCTGCGCTCATCATGCGTCTGGTCCAGGCAAGCTCT
GGGAGGGTCAACGTCGACGACGGAAGCGGGCGGGCTGCTATCCTCCAGCGCATCAACGGGACAGACGCCGGCGAA
GGGGAAGCGCCACCCGCCAAGAAGAGCCAGTCTCCGTGGACGGTGACGACGGAATTACGCGGTGCTCAGCAACAC
GCTGTGGCCATCCAAGAGCTGGGAGCAAGCGCAGCGCCCCTTGCCGAGGCAGCGAGTCGGAACGCATCCTACGTC
ATCAACTTCATCGTCAAGCGAGCCATCGGCTCTACCAAGACCGGGGATACGCCGTACCGAAACCTGCTGGATCTG
TTTGTGGACGACTTTACGACCTGCCTCGATTCGCCGGACTGGCCGTCAGCGGAGCTTCTGCTTCGACTCTTGATG
TTCATGATGGTGCAGCTATTCGAGGCCGGAAAGACGGCCGCACCTGCGAAGAACATGGCGCTGGAGTTGCTTGGC
TCTATGAGCGCCGCAATCTCGCGTCTGCGATCGCACGTGAAGAAGACGGCGGGATCTTTTGAGGGCAGCGACACC
AGTGAGCTGTCGCAGTACCTGTCGGAGCTGGCCATTCTCGTTCTCGAGCACAAGAGCCAGGTCGAGCACATCAGC
ACGTGGACGGGGCCCTACCGAGTGTCTCTGGAATACGTCCAGGAGCGTTGCGTTGAGGATCCTCATCTGGCGGCT
GCGGCGTCGTACATGGTGACGAACTGGGCAACTAAGCTTCATATCGCCTATGACAATGCCCAAGAGAGCGACGAC
GAGCGAGATCGTGAGTTTGGTCGCATGGCTTACCGTCTGCGGATGATGGTTGAGGATCGGAAATGGTTGTCTGGT
CAGTACACGTTCAAAGCCGTGTCGGCCAGTCAGGCCAGGTTCGCATACTCCATCATTCTCCTGCAGTCTCCCCTG
TTTGAGGCCTTTGGCAAGATTGTCAACATCCTGCTGGGTTCCATGGCGAGCGACCAGGCGACGGTACGGAGCAAG
AGTCTCAAGAGCATTCACCAAGTGCTGGAGACGGATCCGTCTATTCTCGACGGCGACTCGACCGTTATACAGCTG
ATCCTCGACTGTGCCAGCGATTCCTCGACCCAGGTGCGAGACTCGGCGCTCGGCTTGTTGGGAAACTGTATAGGG
ATGCGTCGGGCTCTCGAATTGTCGCTGACTCCTAGAATCATAGAGAGATTCCAGGACGCAGGCGTGGGAGTGAGG
AAAAGGGCCATGAAGCTGGCACGCGACATCTACCTCCGAAACAGAAGCAAGACGCTGCGCAGCGCCATCGCCAAC
GGTCTACTTCGTCGAGTACAGGATCCGGACGAGGGCGTACGCGATCTGTCGAGGCAGATGATTGAGGAGGTTTGG
TTTGCGCCTTTTTACTCCAACGAAAACACGGCAGCGTTCGAGACGTCTCTTGGAGAGCACGTTGCCCTCATCATC
CAGACGGTCAAGACGGGAACAGTGACCGAGGTCCTCGACAAGGTGTTCCAGACGGTGCTCAGGCCCCAGAACAGG
TCGCTTGAAGGACCCTTTTCAGTGTGTTCGAGGCTAGTCAGAACCATGTTTGGGATGATCGACAACCCCGATTCA
GAAGATACCACGGTTCCGTCCGGACGCGACGCGTTGCAGGTTCTCACCATCTTCGCCAAGGCGGACCCCAAGCTC
TTCAACTTTGAACAGATCCGGCTGCTTAAGCCTCAGCTGGCGAGCTTCTCTGGCCGCGAGGAGTTGGCCGCGTTT
CGAGCGGTGACTGTGATTTACAAGCGGGTGCTTCCGCAGCTACCGATGGTCCACGCAGAGTTTCTGGCCGAGGTT
CGGCTTCAGCTTCTCAAGGCCATCGGTAAGATCTTTTCTCGCGTCGCTCTCGACGACCTGATTGCCTGCACGCAA
GCCGTCTGCGAGCTGCTCAAGGACTTTGCGCCTCTGGCCAACCTCGTCGCATCGAGTCTTCTGGGCATTCAGAAA
CTGGGCAAGGGTAAGCTGGACAAGAGAGGACTCGGGCAGCTGTGCGCCTACGCCATCATCGTGGGGAGCGTCGGC
AAGCACTCGGATCTGGATCAACAGCTTCAGGTCTTTCGCGATCGGTTTCCTCAGTGGAAGGGAGACTCGGTTCCT
CGGCTCATCGTCGACATGCTTGCGCCATTTGCCTCGCCGACGCAGACTCTCGAAGCTCGCAAGGCGGCGATCGAA
GCCATAGGGCTGGTGTGCCAGTCGTGGCCTCGCAACTACGTCCTGGCCAAGGTCTATACAGCCTTTCAGCAGGTA
TTCCAGGACCAAGTTCAGGCTCTGGAAGCCCTCGTCCTCCGATCGTTCAAGGAGTTTCTCATGACGGAGGAGAAG
CGATCCGAGGCCGGCATCGAGGCCGGATCGGGAGACAAGAAGAAGGAGTTGACGGTCATGGGCGGGACCAACTTT
GACGACGTGGCGAGCGCAACGACTCAGCGGTTTCTAAAGGACATGACGCGGATAGCGCTTGGAAGCCAGGATGAC
CACGCCTTTCTGGCCATGGAGGTGCTGAGCAGCATCAACCGACAGGGGCTGACGCACCCCAAGGAGACGGGGCTG
ACGCTGATGACGCTGGAGACGTCGGCCAACCGAAAGATTGCCGAGCTCGCTTACATGGAACACCGGGCGCTGCAC
GAGAAGCACGAGACGGTGCTGGAGAGGGAGTACATCAAGGCTGTGCAGTCGGCGTACGGCTACCAGCGAGACGTG
GTCCAGGACTGCCGGGGGGCGACCAAGGAGCCGCTACAGTCGAAGCTGCACCTGCTGATGGAGGTTCTCAAGATC
AGCAAGATGAAGAACCGACAGCGGTTCCTGGAGAAGCTGTGCGGACAAATCGACTTTGATCTGGCCAAGCTGGAA
GAGACAACCCCTGAAGGCATGCCGGAACACGTGGGCTTTGCCAGGTTCGTGATCGAGAGCGTAGCCTTTATCGAG
TTCCAGACGGCGGGCGAGGTTCAGACGACGGTCAACGCCCTGGAAAAGATTGTGGCCAGCACAGGGGCTACGGTG
GCACAGGCGATCGAGTCGGAAGTCTTTAATCTCCGGATGGACGCGGACGAGCCGACAAACGATAGCATGGTCACG
ACGACGGAAGCCACGGCGGTGACGGTACGGCCCAAGATCGAGTCACGGCGACTGAGACAGCTGGCGGCTGCGTCG
GTGATGCTGCTTCTGGTGTGGGAGACGCGGACACACATACGGAAGCTGTACGGCATGGGAACGCATCGACACGAC
AGCAAGGCCAAGGCGCTGGCCAAGGACCTGAACAAGACGCCGACCAAGGTGCAGGGCGTGCACGGGGAGCGGCTC
TGGGACGAGCTGACGAACCACATGGGCGGTCTGGACAGCGAGGAGCGGATGGCCATCAAGTGCCGCGAGCTGGTT
GAGCTGATGACGGTCGACAAGGAGTTCCAGGTGGCGGACAAGGACTCGGGCGATGACGACATGGCAGACGGACCG
GCGACGCCGAGCGACGGAGACGACGGGGAGGAGGCTCCGGAGCGGGGCCGGAAGCGAAAAGGGGCGGCAACGCCG
GGAGGCCGGAAGAAGAGGGCGAGGTCGGGCTCACAGCCGAGGAAACGGGGCCGTCCACGGAAGCAGAGCGAGGAG
GCCGACATGAACGGGGACTGGATCTAG
Transcript >Ophun1|1189
ATGCTGCCACGCGCACCAAACGGTCCCGAGAATGGGGTCCATGCGCTTCAGCCTCCTTCACAACCTCATCCCGCC
ATCTCGCGACCCTTTACGCTGCAAGAGTCGCTGCCTTACTCGCCCCAGACGTCGATGACGCCCCTTCTCCCTGAC
GTCATTCCCGATCCAACCTTGGGATCCGGTTCGCCCGCTCTGCCCATCTCGGGCCTGTTCCCGCGAGACGAGTTC
GACAGGGTCAACGCCGAGGCCCTGAATCACCCGCAAGGTTCGAGGGCCTTGAAGCAGGCTGCAGACTATGTGCTG
CACGACCTGAAGCCGTCCCAAAGAACACAATACAAATTCTCGGCCATACCCTCAGGACCCCCTGGCATGACCCCC
GGGAAAAGCCTTTCTCAGGGTCTCTCGCCCATGACCAGAAACGTTTACGACCGGGTGGGCAGTTTCTTCAAGTCG
ACCAAAGCCAACGTCACAGGTTCGAAGACGAATGGCGACTCCCATGAGCCGCTGAAATCGGGCAAACAATCTCCC
TCGCTCAGCTCCAAAGCTCCTCCCAATATGCAAAACCGACGATCAGAGAATCCCGAGTCACATAGATCTCCCTCC
TTTAGGATAGAGGTGGCTATCCCTGCGAAAAAGGCCTTTGACCCGAGTTCTTATATCGAAGTCGCGAGCTCCGCC
CACCCGGACCCGATCCCACGGTCGGTGTCTCAGGAGCTTCCCGCAAAGGCCAAGCCTTCTGCTTTCAACGACGAC
GCCACAACCTTCAAAGAGCCATCCCCTGCGGGCGGAAAGAACCTGGCCTTTAGCATAGAGCTGCCCAAGGCCAAT
ATCAAGAAGGAAGAGTACGTCGAGGTTTGCGAGGTCCCGGACGCTCCCGCAAGCCTCTCGACCCGGCGATCGGGA
ACACATGACGTCGCTCCTAACCAGGGCGTCACCGTTACCAGCCTTGATCAGCGTCAGAGGAGCGAGGTGGCTTTG
GAAGCCTTTGACGCGCTTTTCCGATCCATTAGCGGTGCGGTTGGAAGCGCTTACGCCATGGAACCAGGAACAGAG
CACATCGTGACCATGACGGCGGATCAGGAGCCCGTCATGACCTCGGCCACGCAGCAAAAGCTGCACGGCGCCATT
CAGAAGATTATCGATCTGAGGTGCTTCGATAGTGTGGCTCTGGAAACTTTGCTACACATCGTCAAGCTGTGCGAA
CCAACGCTGAGACAAGTCGAAAGCCTGGAGTTTCGCGTCGACGAGAGCTGGGATGAAGGGGCCGTCGAGTCTTGG
GTCCAGCAGCTATCTGAGCTGGAAACGGCGTTGAAAGCTGCGCGAACTTGCTTGCGCTTGCTCTCCGGAGGTCGC
GAAGACAAGCAACTGTACTCGGAGTCGACTATTCAACGGTGCGTTGATCTCTTCAAGTCGGTCACTGAAGACCTG
GTCATACCCTTGGTCGAACTGCGACCGTCTTCCGGCCTTTTCAAGTTGGTGCAGAAACACAAAAAGGCCGTGTCG
TCGACCTTTGTCTGTTGCCAGAAGCTGTTTGCTCTGCTTGCGGAGCTCGTAACCAAGATTGAGCTCTCCGAGTCA
GTCATCAACACTCTCGAGTACACGTCATCCAAACTCATCTTCGTGGAGAATGCCTACTTTGAGAAGGACTCTGCC
ATCGGTCCTCAGAGGTTTGACGGGATTCGATCCGTTGCCATGGATATGCTCTGCCAGATCTTTCTCATCAAGCCC
GAGCAGAGGCAGGGCATCATCGACGACATACTCACCTCGCTCGAGAAGCTCCCCGTCGGAAAGCAGAGCTCGAGG
CAGTTCAAGCTCTCTGACGGCGGAAGCATTCAGCCCGTCTCTGCGCTCATCATGCGTCTGGTCCAGGCAAGCTCT
GGGAGGGTCAACGTCGACGACGGAAGCGGGCGGGCTGCTATCCTCCAGCGCATCAACGGGACAGACGCCGGCGAA
GGGGAAGCGCCACCCGCCAAGAAGAGCCAGTCTCCGTGGACGGTGACGACGGAATTACGCGGTGCTCAGCAACAC
GCTGTGGCCATCCAAGAGCTGGGAGCAAGCGCAGCGCCCCTTGCCGAGGCAGCGAGTCGGAACGCATCCTACGTC
ATCAACTTCATCGTCAAGCGAGCCATCGGCTCTACCAAGACCGGGGATACGCCGTACCGAAACCTGCTGGATCTG
TTTGTGGACGACTTTACGACCTGCCTCGATTCGCCGGACTGGCCGTCAGCGGAGCTTCTGCTTCGACTCTTGATG
TTCATGATGGTGCAGCTATTCGAGGCCGGAAAGACGGCCGCACCTGCGAAGAACATGGCGCTGGAGTTGCTTGGC
TCTATGAGCGCCGCAATCTCGCGTCTGCGATCGCACGTGAAGAAGACGGCGGGATCTTTTGAGGGCAGCGACACC
AGTGAGCTGTCGCAGTACCTGTCGGAGCTGGCCATTCTCGTTCTCGAGCACAAGAGCCAGGTCGAGCACATCAGC
ACGTGGACGGGGCCCTACCGAGTGTCTCTGGAATACGTCCAGGAGCGTTGCGTTGAGGATCCTCATCTGGCGGCT
GCGGCGTCGTACATGGTGACGAACTGGGCAACTAAGCTTCATATCGCCTATGACAATGCCCAAGAGAGCGACGAC
GAGCGAGATCGTGAGTTTGGTCGCATGGCTTACCGTCTGCGGATGATGGTTGAGGATCGGAAATGGTTGTCTGGT
CAGTACACGTTCAAAGCCGTGTCGGCCAGTCAGGCCAGGTTCGCATACTCCATCATTCTCCTGCAGTCTCCCCTG
TTTGAGGCCTTTGGCAAGATTGTCAACATCCTGCTGGGTTCCATGGCGAGCGACCAGGCGACGGTACGGAGCAAG
AGTCTCAAGAGCATTCACCAAGTGCTGGAGACGGATCCGTCTATTCTCGACGGCGACTCGACCGTTATACAGCTG
ATCCTCGACTGTGCCAGCGATTCCTCGACCCAGGTGCGAGACTCGGCGCTCGGCTTGTTGGGAAACTGTATAGGG
ATGCGTCGGGCTCTCGAATTGTCGCTGACTCCTAGAATCATAGAGAGATTCCAGGACGCAGGCGTGGGAGTGAGG
AAAAGGGCCATGAAGCTGGCACGCGACATCTACCTCCGAAACAGAAGCAAGACGCTGCGCAGCGCCATCGCCAAC
GGTCTACTTCGTCGAGTACAGGATCCGGACGAGGGCGTACGCGATCTGTCGAGGCAGATGATTGAGGAGGTTTGG
TTTGCGCCTTTTTACTCCAACGAAAACACGGCAGCGTTCGAGACGTCTCTTGGAGAGCACGTTGCCCTCATCATC
CAGACGGTCAAGACGGGAACAGTGACCGAGGTCCTCGACAAGGTGTTCCAGACGGTGCTCAGGCCCCAGAACAGG
TCGCTTGAAGGACCCTTTTCAGTGTGTTCGAGGCTAGTCAGAACCATGTTTGGGATGATCGACAACCCCGATTCA
GAAGATACCACGGTTCCGTCCGGACGCGACGCGTTGCAGGTTCTCACCATCTTCGCCAAGGCGGACCCCAAGCTC
TTCAACTTTGAACAGATCCGGCTGCTTAAGCCTCAGCTGGCGAGCTTCTCTGGCCGCGAGGAGTTGGCCGCGTTT
CGAGCGGTGACTGTGATTTACAAGCGGGTGCTTCCGCAGCTACCGATGGTCCACGCAGAGTTTCTGGCCGAGGTT
CGGCTTCAGCTTCTCAAGGCCATCGGTAAGATCTTTTCTCGCGTCGCTCTCGACGACCTGATTGCCTGCACGCAA
GCCGTCTGCGAGCTGCTCAAGGACTTTGCGCCTCTGGCCAACCTCGTCGCATCGAGTCTTCTGGGCATTCAGAAA
CTGGGCAAGGGTAAGCTGGACAAGAGAGGACTCGGGCAGCTGTGCGCCTACGCCATCATCGTGGGGAGCGTCGGC
AAGCACTCGGATCTGGATCAACAGCTTCAGGTCTTTCGCGATCGGTTTCCTCAGTGGAAGGGAGACTCGGTTCCT
CGGCTCATCGTCGACATGCTTGCGCCATTTGCCTCGCCGACGCAGACTCTCGAAGCTCGCAAGGCGGCGATCGAA
GCCATAGGGCTGGTGTGCCAGTCGTGGCCTCGCAACTACGTCCTGGCCAAGGTCTATACAGCCTTTCAGCAGGTA
TTCCAGGACCAAGTTCAGGCTCTGGAAGCCCTCGTCCTCCGATCGTTCAAGGAGTTTCTCATGACGGAGGAGAAG
CGATCCGAGGCCGGCATCGAGGCCGGATCGGGAGACAAGAAGAAGGAGTTGACGGTCATGGGCGGGACCAACTTT
GACGACGTGGCGAGCGCAACGACTCAGCGGTTTCTAAAGGACATGACGCGGATAGCGCTTGGAAGCCAGGATGAC
CACGCCTTTCTGGCCATGGAGGTGCTGAGCAGCATCAACCGACAGGGGCTGACGCACCCCAAGGAGACGGGGCTG
ACGCTGATGACGCTGGAGACGTCGGCCAACCGAAAGATTGCCGAGCTCGCTTACATGGAACACCGGGCGCTGCAC
GAGAAGCACGAGACGGTGCTGGAGAGGGAGTACATCAAGGCTGTGCAGTCGGCGTACGGCTACCAGCGAGACGTG
GTCCAGGACTGCCGGGGGGCGACCAAGGAGCCGCTACAGTCGAAGCTGCACCTGCTGATGGAGGTTCTCAAGATC
AGCAAGATGAAGAACCGACAGCGGTTCCTGGAGAAGCTGTGCGGACAAATCGACTTTGATCTGGCCAAGCTGGAA
GAGACAACCCCTGAAGGCATGCCGGAACACGTGGGCTTTGCCAGGTTCGTGATCGAGAGCGTAGCCTTTATCGAG
TTCCAGACGGCGGGCGAGGTTCAGACGACGGTCAACGCCCTGGAAAAGATTGTGGCCAGCACAGGGGCTACGGTG
GCACAGGCGATCGAGTCGGAAGTCTTTAATCTCCGGATGGACGCGGACGAGCCGACAAACGATAGCATGGTCACG
ACGACGGAAGCCACGGCGGTGACGGTACGGCCCAAGATCGAGTCACGGCGACTGAGACAGCTGGCGGCTGCGTCG
GTGATGCTGCTTCTGGTGTGGGAGACGCGGACACACATACGGAAGCTGTACGGCATGGGAACGCATCGACACGAC
AGCAAGGCCAAGGCGCTGGCCAAGGACCTGAACAAGACGCCGACCAAGGTGCAGGGCGTGCACGGGGAGCGGCTC
TGGGACGAGCTGACGAACCACATGGGCGGTCTGGACAGCGAGGAGCGGATGGCCATCAAGTGCCGCGAGCTGGTT
GAGCTGATGACGGTCGACAAGGAGTTCCAGGTGGCGGACAAGGACTCGGGCGATGACGACATGGCAGACGGACCG
GCGACGCCGAGCGACGGAGACGACGGGGAGGAGGCTCCGGAGCGGGGCCGGAAGCGAAAAGGGGCGGCAACGCCG
GGAGGCCGGAAGAAGAGGGCGAGGTCGGGCTCACAGCCGAGGAAACGGGGCCGTCCACGGAAGCAGAGCGAGGAG
GCCGACATGAACGGGGACTGGATCTAG
Gene >Ophun1|1189
ATGCTGCCACGCGCACCAAACGGTCCCGAGAATGGGGTCCATGCGCTTCAGCCTCCTTCACAACCTCATCCCGCC
ATCTCGCGACCCTTTACGCTGCAAGAGTCGCTGCCTTACTCGCCCCAGACGTCGATGACGCCCCTTCTCCCTGGT
TAGTGGCCTCAACATCAGCGCAAAGTTCGTACTGACGTTGCTGCCTAGACGTCATTCCCGATCCAACCTTGGGAT
CCGGTTCGCCCGCTCTGCCCATCTCGGGCCTGTTCCCGCGAGACGAGTTCGACAGGGTCAACGCCGAGGCCCTGA
ATCACCCGCAAGGTTCGAGGGCCTTGAAGCAGGCTGCAGACTATGTGCTGCACGACCTGAAGCCGTCCCAAAGAA
CACAATAGTTGGTCTCATCTTCACCTCCGTGTCCATTCGTATCGGCTGACCGTCTTTCAGCAAATTCTCGGCCAT
ACCCTCAGGACCCCCTGGCATGACCCCCGGGAAAAGCCTTTCTCAGGGTCTCTCGCCCATGACCAGAAACGTTTA
CGACCGGGTGGGCAGTTTCTTCAAGTCGACCAAAGCCAACGTCACAGGTTCGAAGACGAATGGCGACTCCCATGA
GCCGCTGAAATCGGGCAAACAATCTCCCTCGCTCAGCTCCAAAGCTCCTCCCAATATGCAAAACCGACGATCAGA
GAATCCCGAGTCACATAGATCTCCCTCCTTTAGGATAGAGGTGGCTATCCCTGCGAAAAAGGCCTTTGACCCGAG
TTCTTATATCGAAGTCGCGAGCTCCGCCCACCCGGACCCGATCCCACGGTCGGTGTCTCAGGAGCTTCCCGCAAA
GGCCAAGCCTTCTGCTTTCAACGACGACGCCACAACCTTCAAAGAGCCATCCCCTGCGGGCGGAAAGAACCTGGC
CTTTAGCATAGAGCTGCCCAAGGCCAATATCAAGAAGGAAGAGTACGTCGAGGTTTGCGAGGTCCCGGACGCTCC
CGCAAGCCTCTCGACCCGGCGATCGGGAACACATGACGTCGCTCCTAACCAGGGCGTCACCGTTACCAGCCTTGA
TCAGCGTCAGAGGAGCGAGGTGGCTTTGGAAGCCTTTGACGCGCTTTTCCGATCCATTAGCGGTGCGGTTGGAAG
CGCTTACGCCATGGAACCAGGAACAGAGCACATCGTGACCATGACGGCGGATCAGGAGCCCGTCATGACCTCGGC
CACGCAGCAAAAGCTGCACGGCGCCATTCAGAAGATTATCGATCTGAGGTGCTTCGATAGTGTGGCTCTGGAAAC
TTTGCTACACATCGTCAAGCTGTGCGAACCAACGCTGAGACAAGTCGAAAGCCTGGAGTTTCGCGTCGACGAGAG
CTGGGATGAAGGGGCCGTCGAGTCTTGGGTCCAGCAGCTATCTGAGCTGGAAACGGCGTTGAAAGCTGCGCGAAC
TTGCTTGCGCTTGCTCTCCGGAGGTCGCGAAGACAAGCAACTGTACTCGGAGTCGACTATTCAACGGTGCGTTGA
TCTCTTCAAGTCGGTCACTGAAGACCTGGTCATACCCTTGGTCGAACTGCGACCGTCTTCCGGCCTTTTCAAGTT
GGTGCAGAAACACAAAAAGGCCGTGTCGTCGACCTTTGTCTGTTGCCAGAAGCTGTTTGCTCTGCTTGCGGAGCT
CGTAACCAAGATTGAGCTCTCCGAGTCAGTCATCAACACTCTCGAGTACACGTCATCCAAACTCATCTTCGTGGA
GAATGCCTACTTTGAGAAGGACTCTGCCATCGGTCCTCAGAGGTTTGACGGGATTCGATCCGTTGCCATGGATAT
GCTCTGCCAGATCTTTCTCATCAAGCCCGAGCAGAGGCAGGGCATCATCGACGACATACTCACCTCGCTCGAGAA
GCTCCCCGTCGGAAAGCAGAGCTCGAGGCAGTTCAAGCTCTCTGACGGCGGAAGCATTCAGCCCGTCTCTGCGCT
CATCATGCGTCTGGTCCAGGCAAGCTCTGGGAGGGTCAACGTCGACGACGGAAGCGGGCGGGCTGCTATCCTCCA
GCGCATCAACGGGACAGACGCCGGCGAAGGGGAAGCGCCACCCGCCAAGAAGAGCCAGTCTCCGTGGACGGTGAC
GACGGAATTACGCGGTGCTCAGCAACACGCTGTGGCCATCCAAGAGCTGGGAGCAAGCGCAGCGCCCCTTGCCGA
GGCAGCGAGTCGGAACGCATCCTACGTCATCAACTTCATCGTCAAGCGAGCCATCGGCTCTACCAAGACCGGGGA
TACGCCGTACCGAAACCTGCTGGATCTGTTTGTGGACGACTTTACGACCTGCCTCGATTCGCCGGACTGGCCGTC
AGCGGAGCTTCTGCTTCGACTCTTGATGTTCATGATGGTGCAGCTATTCGAGGCCGGAAAGACGGCCGCACCTGC
GAAGAACATGGCGCTGGAGTTGCTTGGCTCTATGAGCGCCGCAATCTCGCGTCTGCGATCGCACGTGAAGAAGAC
GGCGGGATCTTTTGAGGGCAGCGACACCAGTGAGCTGTCGCAGTACCTGTCGGAGCTGGCCATTCTCGTTCTCGA
GCACAAGAGCCAGGTCGAGCACATCAGCACGTGGACGGGGCCCTACCGAGTGTCTCTGGAATACGTCCAGGAGCG
TTGCGTTGAGGATCCTCATCTGGCGGCTGCGGCGTCGTACATGGTGACGAACTGGGCAACTAAGCTTCATATCGC
CTATGACAATGCCCAAGAGAGCGACGACGAGCGAGATCGTGAGTTTGGTCGCATGGCTTACCGTCTGCGGATGAT
GGTTGAGGATCGGAAATGGTTGTCTGGTCAGTACACGTTCAAAGCCGTGTCGGCCAGTCAGGCCAGGTTCGCATA
CTCCATCATTCTCCTGCAGTCTCCCCTGTTTGAGGCCTTTGGCAAGATTGTCAACATCCTGCTGGGTTCCATGGC
GAGCGACCAGGCGACGGTACGGAGCAAGAGTCTCAAGAGCATTCACCAAGTGCTGGAGACGGATCCGTCTATTCT
CGACGGCGACTCGACCGTTATACAGCTGATCCTCGACTGTGCCAGCGATTCCTCGACCCAGGTGCGAGACTCGGC
GCTCGGCTTGTTGGGAAACTGTATAGGGATGCGTCGGGCTCTCGAATTGTCGCTGACTCCTAGAATCATAGAGAG
ATTCCAGGACGCAGGCGTGGGAGTGAGGAAAAGGGCCATGAAGCTGGCACGCGACATCTACCTCCGAAACAGAAG
CAAGACGCTGCGCAGCGCCATCGCCAACGGTCTACTTCGTCGAGTACAGGATCCGGACGAGGGCGTACGCGATCT
GTCGAGGCAGATGATTGAGGAGGTTTGGTTTGCGCCTTTTTACTCCAACGAAAACACGGCAGCGTTCGAGACGTC
TCTTGGAGAGCACGTTGCCCTCATCATCCAGACGGTCAAGACGGGAACAGTGACCGAGGTCCTCGACAAGGTGTT
CCAGACGGTGCTCAGGCCCCAGAACAGGTCGCTTGAAGGACCCTTTTCAGTGTGTTCGAGGCTAGTCAGAACCAT
GTTTGGGATGATCGACAACCCCGATTCAGAAGATACCACGGTTCCGTCCGGACGCGACGCGTTGCAGGTTCTCAC
CATCTTCGCCAAGGCGGACCCCAAGCTCTTCAACTTTGAACAGATCCGGCTGCTTAAGCCTCAGCTGGCGAGCTT
CTCTGGCCGCGAGGAGTTGGCCGCGTTTCGAGCGGTGACTGTGATTTACAAGCGGGTGCTTCCGCAGCTACCGAT
GGTCCACGCAGAGTTTCTGGCCGAGGTTCGGCTTCAGCTTCTCAAGGCCATCGGTAAGATCTTTTCTCGCGTCGC
TCTCGACGACCTGATTGCCTGCACGCAAGCCGTCTGCGAGCTGCTCAAGGACTTTGCGCCTCTGGCCAACCTCGT
CGCATCGAGTCTTCTGGGCATTCAGAAACTGGGCAAGGGTAAGCTGGACAAGAGAGGACTCGGGCAGCTGTGCGC
CTACGCCATCATCGTGGGGAGCGTCGGCAAGCACTCGGATCTGGATCAACAGCTTCAGGTCTTTCGCGATCGGTT
TCCTCAGTGGAAGGGAGACTCGGTTCCTCGGCTCATCGTCGACATGCTTGCGCCATTTGCCTCGCCGACGCAGAC
TCTCGAAGCTCGCAAGGCGGCGATCGAAGCCATAGGGCTGGTGTGCCAGTCGTGGCCTCGCAACTACGTCCTGGC
CAAGGTCTATACAGCCTTTCAGCAGGTATTCCAGGACCAAGTTCAGGCTCTGGAAGCCCTCGTCCTCCGATCGTT
CAAGGAGTTTCTCATGACGGAGGAGAAGCGATCCGAGGCCGGCATCGAGGCCGGATCGGGAGACAAGAAGAAGGA
GTTGACGGTCATGGGCGGGACCAACTTTGACGACGTGGCGAGCGCAACGACTCAGCGGTTTCTAAAGGACATGAC
GCGGATAGCGCTTGGAAGCCAGGATGACCACGCCTTTCTGGCCATGGAGGTGCTGAGCAGCATCAACCGACAGGG
GCTGACGCACCCCAAGGAGACGGGGCTGACGCTGATGACGCTGGAGACGTCGGCCAACCGAAAGATTGCCGAGCT
CGCTTACATGGAACACCGGGCGCTGCACGAGAAGCACGAGACGGTGCTGGAGAGGGAGTACATCAAGGCTGTGCA
GTCGGCGTACGGCTACCAGCGAGACGTGGTCCAGGACTGCCGGGGGGCGACCAAGGAGCCGCTACAGTCGAAGCT
GCACCTGCTGATGGAGGTTCTCAAGATCAGCAAGATGAAGAACCGACAGCGGTTCCTGGAGAAGCTGTGCGGACA
AATCGACTTTGATCTGGCCAAGCTGGAAGAGACAACCCCTGAAGGCATGCCGGAACACGTGGGCTTTGCCAGGTT
CGTGATCGAGAGCGTAGCCTTTATCGAGTTCCAGACGGCGGGCGAGGTTCAGACGACGGTCAACGCCCTGGAAAA
GATTGTGGCCAGCACAGGGGCTACGGTGGCACAGGCGATCGAGTCGGAAGTCTTTAATCTCCGGATGGACGCGGA
CGAGCCGACAAACGATAGCATGGTCACGACGACGGAAGCCACGGCGGTGACGGTACGGCCCAAGATCGAGTCACG
GCGACTGAGACAGCTGGCGGCTGCGTCGGTGATGCTGCTTCTGGTGTGGGAGACGCGGACACACATACGGAAGCT
GTACGGCATGGGAACGCATCGACACGACAGCAAGGCCAAGGCGCTGGCCAAGGACCTGAACAAGACGCCGACCAA
GGTGCAGGGCGTGCACGGGGAGCGGCTCTGGGACGAGCTGACGAACCACATGGGCGGTCTGGACAGCGAGGAGCG
GATGGCCATCAAGTGCCGCGAGCTGGTTGAGCTGATGACGGTCGACAAGGAGTTCCAGGTGGCGGACAAGGACTC
GGGCGATGACGACATGGCAGACGGACCGGCGACGCCGAGCGACGGAGACGACGGGGAGGAGGCTCCGGAGCGGGG
CCGGAAGCGAAAAGGGGCGGCAACGCCGGGAGGCCGGAAGAAGAGGGCGAGGTCGGGCTCACAGCCGAGGAAACG
GGGCCGTCCACGGAAGCAGAGCGAGGAGGCCGACATGAACGGGGACTGGATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail