Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1188
Gene name
LocationContig_146:322..2188
Strand+
Gene length (bp)1866
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.4E-21 79 231
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 9.1E-24 334 474

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 53 486 1.0E-76
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 78 480 2.0E-76
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 57 485 4.0E-76
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 52 486 8.0E-61
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 317 481 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 53 486 1.0E-76
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 78 480 2.0E-76
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 57 485 4.0E-76
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 52 486 8.0E-61
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 317 481 2.0E-49
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 318 481 7.0E-45
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 16 275 1.0E-43
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 28 239 6.0E-40
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 52 243 1.0E-39
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 18 246 7.0E-38
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 324 477 7.0E-38
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 53 244 2.0E-37
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 78 245 2.0E-36
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 333 485 5.0E-34
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 311 477 2.0E-33
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 312 486 3.0E-33
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 319 477 5.0E-33
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 322 487 1.0E-32
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 344 481 1.0E-32
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 333 486 3.0E-31
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 60 246 4.0E-31
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 6 244 3.0E-30
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 311 481 4.0E-30
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 6 238 7.0E-29
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 60 238 2.0E-28
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 8 231 6.0E-28
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 80 479 6.0E-28
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 79 479 8.0E-27
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 50 245 1.0E-25
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 330 477 8.0E-25
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 332 477 2.0E-20
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 50 238 2.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 52 74 22
2 79 98 19
3 111 133 22
4 143 165 22
5 172 194 22
6 209 231 22
7 331 353 22
8 368 390 22
9 397 419 22
10 434 453 19
11 458 480 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1188
MTTVNHFRNRRQAHAVSRASSDQAWNPFRHVWGERAQTWAGGEGLSEGGRTFLNSWINTLLVAAPVGIAINYVPS
IPRVAVFIVNFVAIIPLAAMLSFATEEIALRTGETLGGLLNATFGNAVEVIVSIIALLEGKIQIVKTSLIGSILS
NLLLVMGCCFFFGGLRRPEQHFNTVVAQTAASLLALAAASVIVPTVFDAAQNTPPAKVAALSRGTAVILLIVYAA
YLFFQLKTHQNVFSQESQKVPAKPWATPTTTTAASRGNVHRAVVVPGSLMGGGLQGEEANQRLSRMLMNPLRFDK
NGDIKESKGPDEDGNSQDEDEEEEDPQLHFAVALATLTLSTAIIALCAEFMVSSIDAVTRNGSLSEEFLGLILLP
IVGNAAEHATAVTVAIKDKMDLAIGVAVGSSMQIALFVIPFIVLVGWGLGDDTMNLSFDFFQTATMFMAVLLANY
LIGDGKSHWLEGFLLICLYAIIGVCAFYYPNSAADQTA*
Coding >Ophun1|1188
ATGACGACAGTCAACCACTTCCGCAACAGGAGGCAGGCCCACGCCGTCAGCCGCGCCAGCTCGGATCAGGCGTGG
AATCCGTTCCGCCATGTCTGGGGGGAGAGGGCGCAGACGTGGGCTGGGGGTGAGGGCTTGAGTGAGGGGGGGCGA
ACCTTCCTCAACTCATGGATCAACACGCTGCTGGTGGCCGCCCCCGTGGGCATCGCCATCAACTACGTGCCCTCG
ATCCCGCGCGTCGCCGTCTTCATCGTCAACTTCGTCGCCATCATCCCCCTCGCCGCCATGCTGAGCTTCGCCACC
GAGGAGATTGCCCTGCGCACGGGGGAGACGTTGGGCGGGCTGCTCAACGCTACCTTTGGGAATGCCGTTGAGGTC
ATTGTCAGTATTATTGCGTTGCTGGAGGGGAAGATTCAGATTGTCAAGACGTCTCTTATTGGCTCCATCCTCTCA
AACCTCCTCCTCGTCATGGGCTGCTGCTTCTTCTTCGGCGGCCTCCGCCGTCCAGAACAACACTTCAACACCGTC
GTCGCCCAAACAGCCGCCTCCCTCCTCGCCCTAGCCGCCGCCTCCGTCATCGTCCCCACCGTCTTCGACGCCGCG
CAAAACACCCCCCCCGCAAAAGTGGCCGCCCTCTCCCGCGGAACAGCCGTCATCCTCCTCATCGTCTACGCCGCC
TACCTCTTCTTCCAGCTCAAGACGCACCAGAACGTCTTCAGCCAGGAGAGTCAAAAGGTTCCGGCGAAACCCTGG
GCTACACCCACGACGACGACGGCGGCGTCTAGGGGGAATGTTCATCGCGCGGTCGTGGTGCCCGGGTCGTTGATG
GGGGGTGGCTTGCAGGGAGAGGAGGCGAATCAACGACTTTCGCGGATGTTGATGAATCCTCTTCGCTTCGATAAG
AACGGCGACATCAAAGAGAGCAAAGGCCCAGACGAAGACGGCAACAGCCAAGACGAAGACGAAGAAGAAGAAGAT
CCCCAACTCCACTTCGCCGTCGCCCTCGCAACCCTAACCCTCTCAACCGCCATCATCGCCCTCTGCGCCGAATTC
ATGGTCTCCTCCATCGACGCCGTAACCCGCAACGGCAGCCTCTCGGAAGAATTCCTCGGCCTCATCCTCCTCCCC
ATCGTCGGCAACGCCGCCGAGCACGCCACCGCCGTCACCGTCGCCATCAAGGACAAGATGGACCTGGCCATTGGC
GTCGCCGTCGGCTCCAGCATGCAGATCGCCCTCTTCGTCATCCCCTTCATCGTGCTGGTGGGCTGGGGCCTCGGC
GATGATACCATGAATCTTAGCTTTGATTTCTTCCAGACGGCCACCATGTTTATGGCTGTGTTGCTGGCCAATTAT
CTGATTGGGGATGGGAAGAGTCATTGGTTGGAGGGGTTCTTGCTCATCTGTCTTTATGCCATCATCGGCGTTTGC
GCTTTCTATTATCCCAATTCGGCCGCTGATCAGACGGCTTGA
Transcript >Ophun1|1188
ATGACGACAGTCAACCACTTCCGCAACAGGAGGCAGGCCCACGCCGTCAGCCGCGCCAGCTCGGATCAGGCGTGG
AATCCGTTCCGCCATGTCTGGGGGGAGAGGGCGCAGACGTGGGCTGGGGGTGAGGGCTTGAGTGAGGGGGGGCGA
ACCTTCCTCAACTCATGGATCAACACGCTGCTGGTGGCCGCCCCCGTGGGCATCGCCATCAACTACGTGCCCTCG
ATCCCGCGCGTCGCCGTCTTCATCGTCAACTTCGTCGCCATCATCCCCCTCGCCGCCATGCTGAGCTTCGCCACC
GAGGAGATTGCCCTGCGCACGGGGGAGACGTTGGGCGGGCTGCTCAACGCTACCTTTGGGAATGCCGTTGAGGTC
ATTGTCAGTATTATTGCGTTGCTGGAGGGGAAGATTCAGATTGTCAAGACGTCTCTTATTGGCTCCATCCTCTCA
AACCTCCTCCTCGTCATGGGCTGCTGCTTCTTCTTCGGCGGCCTCCGCCGTCCAGAACAACACTTCAACACCGTC
GTCGCCCAAACAGCCGCCTCCCTCCTCGCCCTAGCCGCCGCCTCCGTCATCGTCCCCACCGTCTTCGACGCCGCG
CAAAACACCCCCCCCGCAAAAGTGGCCGCCCTCTCCCGCGGAACAGCCGTCATCCTCCTCATCGTCTACGCCGCC
TACCTCTTCTTCCAGCTCAAGACGCACCAGAACGTCTTCAGCCAGGAGAGTCAAAAGGTTCCGGCGAAACCCTGG
GCTACACCCACGACGACGACGGCGGCGTCTAGGGGGAATGTTCATCGCGCGGTCGTGGTGCCCGGGTCGTTGATG
GGGGGTGGCTTGCAGGGAGAGGAGGCGAATCAACGACTTTCGCGGATGTTGATGAATCCTCTTCGCTTCGATAAG
AACGGCGACATCAAAGAGAGCAAAGGCCCAGACGAAGACGGCAACAGCCAAGACGAAGACGAAGAAGAAGAAGAT
CCCCAACTCCACTTCGCCGTCGCCCTCGCAACCCTAACCCTCTCAACCGCCATCATCGCCCTCTGCGCCGAATTC
ATGGTCTCCTCCATCGACGCCGTAACCCGCAACGGCAGCCTCTCGGAAGAATTCCTCGGCCTCATCCTCCTCCCC
ATCGTCGGCAACGCCGCCGAGCACGCCACCGCCGTCACCGTCGCCATCAAGGACAAGATGGACCTGGCCATTGGC
GTCGCCGTCGGCTCCAGCATGCAGATCGCCCTCTTCGTCATCCCCTTCATCGTGCTGGTGGGCTGGGGCCTCGGC
GATGATACCATGAATCTTAGCTTTGATTTCTTCCAGACGGCCACCATGTTTATGGCTGTGTTGCTGGCCAATTAT
CTGATTGGGGATGGGAAGAGTCATTGGTTGGAGGGGTTCTTGCTCATCTGTCTTTATGCCATCATCGGCGTTTGC
GCTTTCTATTATCCCAATTCGGCCGCTGATCAGACGGCTTGA
Gene >Ophun1|1188
ATGACGACAGTCAACCACTTCCGCAACAGGAGGCAGGCCCACGCCGTCAGCCGCGCCAGCTCGGATCAGGCGTGG
AATCCGTTCCGCCATGTCTGGGGGGAGAGGGCGCAGACGTGGGCTGGGGGTGAGGGCTTGAGTGAGGGGGGGGTT
CGTTGTCGGGAGGAGCCTGTTGCGGCTGGGGAGAAGAGAGAGGTCAAGACTCCGGAGCTGGAGGGTGGGAATGGT
CTGGCTTCGTCTGGCGGTGCGGACCGAGAGGGAACGACCAGCGAAGAAACTCGTCACCCCCCAACAACACCACCT
CAACAACAACAACAACAACAACAGCAACCTCAACCTCAACCCCCCCCCAAAAAACCCCTCCTCCGCAAACTCCAA
CCCAAAACCCCCTTCACCACCTCCAACCAACTCCAGCGAACCTTCCTCAACTCATGGATCAACACGCTGCTGGTG
GCCGCCCCCGTGGGCATCGCCATCAACTACGTGCCCTCGATCCCGCGCGTCGCCGTCTTCATCGTCAACTTCGTC
GCCATCATCCCCCTCGCCGCCATGCTGAGCTTCGCCACCGAGGAGATTGCCCTGCGCACGGGGGAGACGTTGGGC
GGGCTGCTCAACGCTACCTTTGGGAATGCCGTTGAGGTCATTGTCAGTATTATTGCGTTGCTGGAGGGGAAGATT
CAGATTGTCAAGACGTCTCTTATTGTGAGTTTCCCCCTTTTCTTTCTTCCTCTGATCCTTTCAACTCATCACAAC
TTTGCTAAATCATCATCATCCAGGGCTCCATCCTCTCAAACCTCCTCCTCGTCATGGGCTGCTGCTTCTTCTTCG
GCGGCCTCCGCCGTCCAGAACAACACTTCAACACCGTCGTCGCCCAAACAGCCGCCTCCCTCCTCGCCCTAGCCG
CCGCCTCCGTCATCGTCCCCACCGTCTTCGACGCCGCGCAAAACACCCCCCCCGCAAAAGTGGCCGCCCTCTCCC
GCGGAACAGCCGTCATCCTCCTCATCGTCTACGCCGCCTACCTCTTCTTCCAGCTCAAGACGCACCAGAACGTCT
TCAGCCAGGAGAGTCAAAAGGTTCCGGCGAAACCCTGGGCTACACCCACGACGACGACGGCGGCGTCTAGGGGGA
ATGTTCATCGCGCGGTCGTGGTGCCCGGGTCGTTGATGGGGGGTGGCTTGCAGGGAGAGGAGGCGAATCAACGAC
TTTCGCGGATGTTGATGAATCCTCTTCGCTTCGATAAGAACGGCGACATCAAAGAGAGCAAAGGCCCAGACGAAG
ACGGCAACAGCCAAGACGAAGACGAAGAAGAAGAAGATCCCCAACTCCACTTCGCCGTCGCCCTCGCAACCCTAA
CCCTCTCAACCGCCATCATCGCCCTCTGCGCCGAATTCATGGTCTCCTCCATCGACGCCGTAACCCGCAACGGCA
GCCTCTCGGAAGAATTCCTCGGCCTCATCCTCCTCCCCATCGTCGGCAACGCCGCCGAGCACGCCACCGCCGTCA
CCGTCGCCATCAAGGACAAGATGGACCTGGCCATTGGCGTCGCCGTCGGCTCCAGCATGCAGATCGCCCTCTTCG
TCATCCCCTTCATCGTGCTGGTGGGCTGGGGCCTCGGCGATGATACCATGAATCTTAGCTTTGATTTCTTCCAGA
CGGCCACCATGTTTATGGCTGTGTTGCTGGCCAATTATCTGATTGGGGATGGGAAGAGTCATTGGTTGGAGGGGT
TCTTGCTCATCTGTCTTTATGCCATCATCGGCGTTTGCGCTTTCTGTGAGTTTTCCATCTTCTCTCCTGGTCTTG
AGGCTTTCGCCGTTGGCTTACGTTCTTGCAGATTATCCCAATTCGGCCGCTGATCAGACGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail