Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1182
Gene name
LocationContig_145:28217..30256
Strand-
Gene length (bp)2039
Transcript length (bp)1968
Coding sequence length (bp)1968
Protein length (aa) 656

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 6.8E-09 306 440
PF00743 FMO-like Flavin-binding monooxygenase-like 2.4E-09 293 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 247 580 2.0E-25
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 257 580 2.0E-24
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 247 580 4.0E-24
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 247 580 3.0E-23
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 247 580 6.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 247 580 2.0E-25
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 257 580 2.0E-24
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 247 580 4.0E-24
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 247 580 3.0E-23
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 247 580 6.0E-23
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 247 580 1.0E-22
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 261 580 2.0E-22
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 247 580 3.0E-21
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 247 580 5.0E-20
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 258 580 3.0E-19
sp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=2 SV=1 237 584 8.0E-19
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 257 578 3.0E-10
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 294 578 9.0E-09
sp|Q5L2G3|CZCO_GEOKA Uncharacterized oxidoreductase CzcO-like OS=Geobacillus kaustophilus (strain HTA426) GN=GK0582 PE=4 SV=1 240 428 2.0E-08
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 257 578 6.0E-08
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 257 578 6.0E-08
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 257 578 1.0E-07
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 257 578 2.0E-07
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 257 578 5.0E-07
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 257 578 6.0E-07
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 290 438 7.0E-07
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 257 578 2.0E-06
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 257 578 3.0E-06
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 257 578 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0003674 molecular_function No
GO:0004497 monooxygenase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup582
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3073
Ophiocordyceps australis map64 (Brazil) OphauB2|475
Ophiocordyceps australis map64 (Brazil) OphauB2|705
Ophiocordyceps camponoti-floridani Ophcf2|02936
Ophiocordyceps camponoti-rufipedis Ophun1|1182 (this protein)
Ophiocordyceps kimflemingae Ophio5|1444
Ophiocordyceps subramaniannii Hirsu2|615
Ophiocordyceps subramaniannii Hirsu2|6710

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1182
MTRCNEATGFNPAPGMQLASQISKFNLPSNRRVCLPSFTVSTMAFPEPVIHPVIELPSVEKPGNVAPEHESQTVI
DGLNEALSKADYRAASNFFIEDGFWRDHLALTWRFRTIRGRDAIAKFLDESSHSRDGFRIKRLALDASSPSRQPQ
AAQIDEEGKVSGIKAFLHVETAIGSGQGFIQLVLQHGKWHVFTLYTSLCQLRGYEEPTLGRRPVGVDHGGHPGRM
NWSERRLLENEVDAQHDLAVLIIAAARFKMLGLSSLIIDQNDRVGDNWRKRYRQLALHDPVWYDHLPYFPFPPNW
PIFTPKDKLAQFFEAYANILELNIWMKSTIESCKWDEPKKRWTVAISRIKDNGTKETRVLYPRHLIQATGHSGQK
YEPQIKGSESFRGDRFCHSSEFPGARQGTSGKKAVIIGCCNSAHDIAQDYFENGYHVTLVQRSSTTVVSTSALTN
VLLGGFYSENGPPVEDADVMSNGLPYVVLKTFQQQLTKLQRRHDHETLTGLKKAGFKVDFGSEDAGLIAKFQERG
GGYYIDVGASKLIVDGSIKIKQGHEVAEILPHGLRLTDGSELEADEIILATGYQNMESRTRSIFGSEVADRVNGV
WGFNEEGEIRTMWQDSGHPGFWFHGSNLGLCRFYSRLLALQIKGLEEGLYGYGEI*
Coding >Ophun1|1182
ATGACTAGATGCAACGAAGCCACCGGCTTCAACCCCGCTCCGGGAATGCAGCTGGCCAGCCAGATATCTAAGTTC
AACCTGCCTTCCAACCGCAGAGTTTGCCTACCCTCCTTCACCGTCTCCACGATGGCCTTTCCGGAGCCAGTCATC
CACCCGGTCATCGAACTCCCCTCTGTCGAGAAGCCTGGGAATGTCGCGCCCGAGCACGAGTCGCAAACGGTCATC
GATGGCTTGAACGAAGCCTTGTCAAAGGCCGATTACCGAGCGGCGTCGAACTTCTTCATCGAGGATGGCTTCTGG
CGTGATCATCTGGCTCTGACTTGGAGGTTCCGAACGATACGTGGGAGAGACGCCATCGCCAAGTTCCTCGACGAG
TCTTCCCATTCGAGAGACGGCTTCCGAATCAAGCGTCTCGCTCTCGACGCCAGCTCTCCCAGTCGGCAGCCACAG
GCGGCTCAGATAGACGAGGAAGGCAAAGTCTCAGGAATCAAGGCCTTCCTCCATGTTGAAACGGCCATCGGATCG
GGCCAGGGCTTCATACAGCTAGTCCTACAGCATGGGAAATGGCACGTCTTCACCTTGTACACCAGCCTCTGCCAA
CTTCGCGGTTATGAAGAGCCGACGCTGGGTCGACGGCCGGTCGGAGTTGATCATGGCGGTCATCCGGGAAGGATG
AATTGGTCTGAGAGACGGCTTCTCGAAAACGAGGTTGACGCACAACATGACCTTGCCGTCTTGATAATCGCTGCC
GCAAGGTTTAAGATGCTCGGTCTCAGCTCCCTCATCATCGATCAGAACGACCGCGTAGGCGACAACTGGCGCAAG
CGATACCGTCAGCTCGCTCTCCACGATCCCGTCTGGTATGATCATCTGCCATATTTCCCCTTCCCACCCAACTGG
CCCATCTTCACCCCGAAAGATAAGCTCGCCCAGTTCTTCGAGGCGTACGCCAATATCCTCGAACTCAACATCTGG
ATGAAGTCGACCATCGAGAGCTGCAAGTGGGATGAGCCCAAGAAGAGATGGACCGTCGCCATCTCACGTATCAAG
GACAATGGCACGAAAGAGACGAGGGTTTTATATCCGCGTCACCTCATTCAAGCGACTGGACACTCTGGACAAAAG
TACGAGCCGCAAATCAAAGGGTCAGAGTCGTTTCGAGGGGATCGCTTCTGCCACTCGTCCGAGTTTCCCGGTGCT
CGCCAAGGTACGAGCGGGAAAAAGGCCGTCATCATCGGTTGCTGCAACTCTGCCCACGACATTGCACAGGACTAC
TTCGAGAATGGCTACCATGTAACCCTGGTTCAGCGATCGAGCACCACCGTAGTATCGACTTCGGCCTTGACGAAT
GTGCTTTTGGGGGGCTTCTACTCGGAGAATGGACCGCCAGTGGAAGACGCGGACGTCATGTCCAACGGTCTTCCC
TACGTCGTTCTAAAGACATTCCAGCAACAATTAACCAAGCTTCAGAGACGGCACGATCACGAGACACTGACTGGT
CTGAAGAAAGCCGGCTTCAAGGTCGACTTCGGGAGCGAAGACGCGGGCCTCATAGCCAAATTTCAGGAGCGAGGA
GGCGGTTATTACATCGACGTCGGAGCCTCCAAACTCATTGTCGACGGCAGCATCAAGATCAAGCAGGGGCACGAA
GTCGCCGAGATCCTCCCCCACGGGCTACGTCTTACCGACGGCTCAGAACTTGAAGCAGATGAGATCATCCTGGCA
ACGGGGTACCAGAACATGGAGAGTCGTACGAGGTCCATCTTCGGATCCGAGGTTGCCGACCGCGTAAACGGGGTT
TGGGGGTTCAACGAAGAGGGAGAGATCCGGACAATGTGGCAGGATAGCGGACACCCTGGCTTCTGGTTTCATGGG
TCGAATCTGGGCTTGTGCAGGTTCTACTCGAGACTTCTGGCGCTGCAGATCAAGGGTTTGGAGGAGGGTCTGTAC
GGTTACGGCGAGATCTGA
Transcript >Ophun1|1182
ATGACTAGATGCAACGAAGCCACCGGCTTCAACCCCGCTCCGGGAATGCAGCTGGCCAGCCAGATATCTAAGTTC
AACCTGCCTTCCAACCGCAGAGTTTGCCTACCCTCCTTCACCGTCTCCACGATGGCCTTTCCGGAGCCAGTCATC
CACCCGGTCATCGAACTCCCCTCTGTCGAGAAGCCTGGGAATGTCGCGCCCGAGCACGAGTCGCAAACGGTCATC
GATGGCTTGAACGAAGCCTTGTCAAAGGCCGATTACCGAGCGGCGTCGAACTTCTTCATCGAGGATGGCTTCTGG
CGTGATCATCTGGCTCTGACTTGGAGGTTCCGAACGATACGTGGGAGAGACGCCATCGCCAAGTTCCTCGACGAG
TCTTCCCATTCGAGAGACGGCTTCCGAATCAAGCGTCTCGCTCTCGACGCCAGCTCTCCCAGTCGGCAGCCACAG
GCGGCTCAGATAGACGAGGAAGGCAAAGTCTCAGGAATCAAGGCCTTCCTCCATGTTGAAACGGCCATCGGATCG
GGCCAGGGCTTCATACAGCTAGTCCTACAGCATGGGAAATGGCACGTCTTCACCTTGTACACCAGCCTCTGCCAA
CTTCGCGGTTATGAAGAGCCGACGCTGGGTCGACGGCCGGTCGGAGTTGATCATGGCGGTCATCCGGGAAGGATG
AATTGGTCTGAGAGACGGCTTCTCGAAAACGAGGTTGACGCACAACATGACCTTGCCGTCTTGATAATCGCTGCC
GCAAGGTTTAAGATGCTCGGTCTCAGCTCCCTCATCATCGATCAGAACGACCGCGTAGGCGACAACTGGCGCAAG
CGATACCGTCAGCTCGCTCTCCACGATCCCGTCTGGTATGATCATCTGCCATATTTCCCCTTCCCACCCAACTGG
CCCATCTTCACCCCGAAAGATAAGCTCGCCCAGTTCTTCGAGGCGTACGCCAATATCCTCGAACTCAACATCTGG
ATGAAGTCGACCATCGAGAGCTGCAAGTGGGATGAGCCCAAGAAGAGATGGACCGTCGCCATCTCACGTATCAAG
GACAATGGCACGAAAGAGACGAGGGTTTTATATCCGCGTCACCTCATTCAAGCGACTGGACACTCTGGACAAAAG
TACGAGCCGCAAATCAAAGGGTCAGAGTCGTTTCGAGGGGATCGCTTCTGCCACTCGTCCGAGTTTCCCGGTGCT
CGCCAAGGTACGAGCGGGAAAAAGGCCGTCATCATCGGTTGCTGCAACTCTGCCCACGACATTGCACAGGACTAC
TTCGAGAATGGCTACCATGTAACCCTGGTTCAGCGATCGAGCACCACCGTAGTATCGACTTCGGCCTTGACGAAT
GTGCTTTTGGGGGGCTTCTACTCGGAGAATGGACCGCCAGTGGAAGACGCGGACGTCATGTCCAACGGTCTTCCC
TACGTCGTTCTAAAGACATTCCAGCAACAATTAACCAAGCTTCAGAGACGGCACGATCACGAGACACTGACTGGT
CTGAAGAAAGCCGGCTTCAAGGTCGACTTCGGGAGCGAAGACGCGGGCCTCATAGCCAAATTTCAGGAGCGAGGA
GGCGGTTATTACATCGACGTCGGAGCCTCCAAACTCATTGTCGACGGCAGCATCAAGATCAAGCAGGGGCACGAA
GTCGCCGAGATCCTCCCCCACGGGCTACGTCTTACCGACGGCTCAGAACTTGAAGCAGATGAGATCATCCTGGCA
ACGGGGTACCAGAACATGGAGAGTCGTACGAGGTCCATCTTCGGATCCGAGGTTGCCGACCGCGTAAACGGGGTT
TGGGGGTTCAACGAAGAGGGAGAGATCCGGACAATGTGGCAGGATAGCGGACACCCTGGCTTCTGGTTTCATGGG
TCGAATCTGGGCTTGTGCAGGTTCTACTCGAGACTTCTGGCGCTGCAGATCAAGGGTTTGGAGGAGGGTCTGTAC
GGTTACGGCGAGATCTGA
Gene >Ophun1|1182
ATGACTAGATGCAACGAAGCCACCGGCTTCAACCCCGCTCCGGGAATGCAGCTGGCCAGCCAGATATCTAAGTTC
AACCTGCCTTCCAACCGCAGAGTTTGCCTACCCTCCTTCACCGTCTCCACGATGGCCTTTCCGGAGCCAGTCATC
CACCCGGTCATCGAACTCCCCTCTGTCGAGAAGCCTGGGAATGTCGCGCCCGAGCACGAGTCGCAAACGGTCATC
GATGGCTTGAACGAAGCCTTGTCAAAGGCCGATTACCGAGCGGCGTCGAACTTCTTCATCGAGGATGGCTTCTGG
CGTGATCATCTGGCTCTGACTTGGAGGTTCCGAACGATACGTGGGAGAGACGCCATCGCCAAGTTCCTCGACGAG
TCTTCCCATTCGAGAGACGGCTTCCGAATCAAGCGTCTCGCTCTCGACGCCAGCTCTCCCAGTCGGCAGCCACAG
GCGGCTCAGATAGACGAGGAAGGCAAAGTCTCAGGAATCAAGGCCTTCCTCCATGTTGAAACGGCCATCGGATCG
GGCCAGGGCTTCATACAGCTAGTCCTACAGCATGGGAAATGGCACGTCTTCACCTTGTACACCAGCCTCTGCCAA
CTTCGCGGTTATGAAGAGCCGACGCTGGGTCGACGGCCGGTCGGAGTTGATCATGGCGGTCATCCGGGAAGGATG
AATTGGTCTGAGAGACGGCTTCTCGAAAACGAGGTTGACGCACAACATGACCTTGCCGTCTTGATAATCGGTAGG
CATACAAGTCTTCCTCCCTTTCGCTCCTACTAAACTTCAAAGGCGCTGGACAAGGCGGCCTGACAGCTGCCGCAA
GGTTTAAGATGCTCGGTCTCAGCTCCCTCATCATCGATCAGAACGACCGCGTAGGCGACAACTGGCGCAAGCGAT
ACCGTCAGCTCGCTCTCCACGATCCCGTCTGGTATGATCATCTGCCATATTTCCCCTTCCCACCCAACTGGCCCA
TCTTCACCCCGAAAGATAAGCTCGCCCAGTTCTTCGAGGCGTACGCCAATATCCTCGAACTCAACATCTGGATGA
AGTCGACCATCGAGAGCTGCAAGTGGGATGAGCCCAAGAAGAGATGGACCGTCGCCATCTCACGTATCAAGGACA
ATGGCACGAAAGAGACGAGGGTTTTATATCCGCGTCACCTCATTCAAGCGACTGGACACTCTGGACAAAAGTACG
AGCCGCAAATCAAAGGGTCAGAGTCGTTTCGAGGGGATCGCTTCTGCCACTCGTCCGAGTTTCCCGGTGCTCGCC
AAGGTACGAGCGGGAAAAAGGCCGTCATCATCGGTTGCTGCAACTCTGCCCACGACATTGCACAGGACTACTTCG
AGAATGGCTACCATGTAACCCTGGTTCAGCGATCGAGCACCACCGTAGTATCGACTTCGGCCTTGACGAATGTGC
TTTTGGGGGGCTTCTACTCGGAGAATGGACCGCCAGTGGAAGACGCGGACGTCATGTCCAACGGTCTTCCCTACG
TCGTTCTAAAGACATTCCAGCAACAATTAACCAAGCTTCAGAGACGGCACGATCACGAGACACTGACTGGTCTGA
AGAAAGCCGGCTTCAAGGTCGACTTCGGGAGCGAAGACGCGGGCCTCATAGCCAAATTTCAGGAGCGAGGAGGCG
GTTATTACATCGACGTCGGAGCCTCCAAACTCATTGTCGACGGCAGCATCAAGATCAAGCAGGGGCACGAAGTCG
CCGAGATCCTCCCCCACGGGCTACGTCTTACCGACGGCTCAGAACTTGAAGCAGATGAGATCATCCTGGCAACGG
GGTACCAGAACATGGAGAGTCGTACGAGGTCCATCTTCGGATCCGAGGTTGCCGACCGCGTAAACGGGGTTTGGG
GGTTCAACGAAGAGGGAGAGATCCGGACAATGTGGCAGGATAGCGGACACCCTGGCTTCTGGTTTCATGGGTCGA
ATCTGGGCTTGTGCAGGTTCTACTCGAGACTTCTGGCGCTGCAGATCAAGGGTTTGGAGGAGGGTCTGTACGGTT
ACGGCGAGATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail