Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1171
Gene name
LocationContig_145:2286..3519
Strand-
Gene length (bp)1233
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10058 zinc_ribbon_10 Predicted integral membrane zinc-ribbon metal-binding protein 7.0E-20 246 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PFM4|LNPB_DANRE Protein lunapark-B OS=Danio rerio GN=lnpb PE=2 SV=2 7 302 9.0E-12
sp|A8XK26|LNP1_CAEBR Protein lunapark-1 OS=Caenorhabditis briggsae GN=lnp-1 PE=3 SV=1 21 302 7.0E-11
sp|Q28HF6|LNP_XENTR Protein lunapark OS=Xenopus tropicalis GN=lnp PE=2 SV=1 20 302 9.0E-11
sp|Q17667|LNP1_CAEEL Protein lunapark-1 OS=Caenorhabditis elegans GN=lnp-1 PE=2 SV=2 11 302 9.0E-11
sp|Q6DFJ8|LNP_XENLA Protein lunapark OS=Xenopus laevis GN=lnp PE=2 SV=1 20 302 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PFM4|LNPB_DANRE Protein lunapark-B OS=Danio rerio GN=lnpb PE=2 SV=2 7 302 9.0E-12
sp|A8XK26|LNP1_CAEBR Protein lunapark-1 OS=Caenorhabditis briggsae GN=lnp-1 PE=3 SV=1 21 302 7.0E-11
sp|Q28HF6|LNP_XENTR Protein lunapark OS=Xenopus tropicalis GN=lnp PE=2 SV=1 20 302 9.0E-11
sp|Q17667|LNP1_CAEEL Protein lunapark-1 OS=Caenorhabditis elegans GN=lnp-1 PE=2 SV=2 11 302 9.0E-11
sp|Q6DFJ8|LNP_XENLA Protein lunapark OS=Xenopus laevis GN=lnp PE=2 SV=1 20 302 1.0E-10
sp|Q7TQ95|LNP_MOUSE Protein lunapark OS=Mus musculus GN=Lnp PE=1 SV=1 35 302 1.0E-08
sp|Q9ZQ34|Y2433_ARATH Uncharacterized protein At2g24330 OS=Arabidopsis thaliana GN=At2g24330 PE=2 SV=1 8 314 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 47 69 22
2 79 101 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1171
MVSFWPWKGDDSSPASFEKTLSALSVKIADSQSRLDRARNSARRTKALWTLYLSFAYVVYAIVLLLVVGHRNLGA
YEWTGMAGGPVLIYGTRALITTLFGFHTDRLADRLRNQLETRAKTIQQLKDATKYDSTMELIEKYGGPDRARSRS
RAPDSGSDSEVSRDKKKNESTTSASNRTLMIPPPTANLPRTLHHDSPKSHLATTPQQQQQQQPKQQQPSPGADFA
PNAFSTHASYAQPASPDSRHWYDRIFDILLGEDEAAPKNRFALICNDCRLVNGQAPPGTKSLAELGPWRCMACGA
LNEHQPDSLVDDADVRGRSTSARDSVSPPVVDEKDQKPAEDPVADGPAAGVRSRRAKAQASK*
Coding >Ophun1|1171
ATGGTGTCGTTTTGGCCCTGGAAGGGCGACGACTCCTCCCCCGCTTCGTTCGAAAAGACGCTCTCGGCTCTCTCG
GTCAAGATCGCAGACTCTCAGTCCCGCCTCGACCGAGCGCGCAACAGCGCCCGACGCACCAAAGCCCTCTGGACC
CTCTACCTGTCCTTCGCTTACGTCGTCTACGCCATCGTCTTGCTCCTCGTTGTGGGCCACCGCAACCTGGGCGCC
TACGAATGGACCGGCATGGCGGGCGGGCCTGTCCTGATATACGGCACGCGCGCTCTCATAACAACCCTCTTCGGC
TTCCACACCGACCGGTTAGCAGACCGGCTACGAAACCAGCTCGAGACGCGCGCAAAGACGATCCAACAGCTCAAA
GATGCTACAAAGTACGATTCAACCATGGAGCTCATCGAAAAGTACGGCGGCCCCGATCGCGCACGCAGCCGCAGC
CGCGCCCCCGACTCCGGCTCCGACTCGGAAGTCAGCCGCGACAAGAAGAAGAATGAATCGACGACATCAGCCTCG
AACCGCACCCTGATGATCCCCCCTCCAACAGCCAACCTCCCACGCACCCTCCACCACGATTCACCCAAATCCCAT
CTCGCCACGACCCCTCAACAACAGCAGCAACAGCAGCCGAAACAACAACAGCCCTCCCCAGGCGCCGACTTCGCC
CCCAACGCCTTCAGCACCCACGCCTCATATGCGCAACCAGCCTCACCCGACTCCCGCCACTGGTACGACCGAATC
TTCGACATCCTCCTCGGCGAGGATGAGGCCGCGCCCAAGAACCGCTTCGCTCTCATCTGCAACGACTGTCGCCTC
GTCAACGGCCAGGCCCCCCCCGGCACAAAGTCCCTAGCCGAGCTGGGTCCCTGGCGCTGCATGGCCTGCGGTGCC
CTGAACGAGCATCAACCCGATTCGCTCGTCGACGATGCCGACGTCCGTGGTCGATCCACATCGGCTCGTGACTCT
GTTTCCCCTCCCGTCGTTGACGAAAAGGATCAGAAGCCCGCCGAGGATCCAGTGGCCGATGGCCCGGCCGCGGGT
GTCCGGTCGCGGCGCGCAAAGGCGCAGGCGTCCAAGTAA
Transcript >Ophun1|1171
ATGGTGTCGTTTTGGCCCTGGAAGGGCGACGACTCCTCCCCCGCTTCGTTCGAAAAGACGCTCTCGGCTCTCTCG
GTCAAGATCGCAGACTCTCAGTCCCGCCTCGACCGAGCGCGCAACAGCGCCCGACGCACCAAAGCCCTCTGGACC
CTCTACCTGTCCTTCGCTTACGTCGTCTACGCCATCGTCTTGCTCCTCGTTGTGGGCCACCGCAACCTGGGCGCC
TACGAATGGACCGGCATGGCGGGCGGGCCTGTCCTGATATACGGCACGCGCGCTCTCATAACAACCCTCTTCGGC
TTCCACACCGACCGGTTAGCAGACCGGCTACGAAACCAGCTCGAGACGCGCGCAAAGACGATCCAACAGCTCAAA
GATGCTACAAAGTACGATTCAACCATGGAGCTCATCGAAAAGTACGGCGGCCCCGATCGCGCACGCAGCCGCAGC
CGCGCCCCCGACTCCGGCTCCGACTCGGAAGTCAGCCGCGACAAGAAGAAGAATGAATCGACGACATCAGCCTCG
AACCGCACCCTGATGATCCCCCCTCCAACAGCCAACCTCCCACGCACCCTCCACCACGATTCACCCAAATCCCAT
CTCGCCACGACCCCTCAACAACAGCAGCAACAGCAGCCGAAACAACAACAGCCCTCCCCAGGCGCCGACTTCGCC
CCCAACGCCTTCAGCACCCACGCCTCATATGCGCAACCAGCCTCACCCGACTCCCGCCACTGGTACGACCGAATC
TTCGACATCCTCCTCGGCGAGGATGAGGCCGCGCCCAAGAACCGCTTCGCTCTCATCTGCAACGACTGTCGCCTC
GTCAACGGCCAGGCCCCCCCCGGCACAAAGTCCCTAGCCGAGCTGGGTCCCTGGCGCTGCATGGCCTGCGGTGCC
CTGAACGAGCATCAACCCGATTCGCTCGTCGACGATGCCGACGTCCGTGGTCGATCCACATCGGCTCGTGACTCT
GTTTCCCCTCCCGTCGTTGACGAAAAGGATCAGAAGCCCGCCGAGGATCCAGTGGCCGATGGCCCGGCCGCGGGT
GTCCGGTCGCGGCGCGCAAAGGCGCAGGCGTCCAAGTAA
Gene >Ophun1|1171
ATGGTGTCGTTTTGGCCCTGGAAGGTCAGCAGCCTCTTCCCCCCATATAGACGAGATAGAACCAGGCTGACGCAT
TATCTTGTGCGTGAAAAGGGCGACGACTCCTCCCCCGCTTCGTTCGAAAAGACGCTCTCGGCTCTCTCGGTCAAG
ATCGCAGACTCTCAGTCCCGCCTCGACCGAGCGCGCAACAGCGCCCGACGCACCAAAGCCCTCTGGACCCTCTAC
CTGTCCTTCGCTTACGTCGTCTACGCCATCGTCTTGCTCCTCGTTGTGGGCCACCGCAACCTGGGCGCCTACGAA
TGGACCGGCATGGCGGGCGGGCCTGTCCTGTAAGCTCAGCCCCCGGTCTTGCAAACCTGCCTCGTCCTCGTCCTC
GACCACGCTGATCAGAATACGGACTATAGGATATACGGCACGCGCGCTCTCATAACAACCCTCTTCGGCTTCCAC
ACCGACCGGTTAGCAGACCGGCTACGAAACCAGCTCGAGACGCGCGCAAAGACGATCCAACAGCTCAAAGATGCT
ACAAAGTACGATTCAACCATGGAGCTCATCGAAAAGTACGGCGGCCCCGATCGCGCACGCAGCCGCAGCCGCGCC
CCCGACTCCGGCTCCGACTCGGAAGTCAGCCGCGACAAGAAGAAGAATGAATCGACGACATCAGCCTCGAACCGC
ACCCTGATGATCCCCCCTCCAACAGCCAACCTCCCACGCACCCTCCACCACGATTCACCCAAATCCCATCTCGCC
ACGACCCCTCAACAACAGCAGCAACAGCAGCCGAAACAACAACAGCCCTCCCCAGGCGCCGACTTCGCCCCCAAC
GCCTTCAGCACCCACGCCTCATATGCGCAACCAGCCTCACCCGACTCCCGCCACTGGTACGACCGAATCTTCGAC
ATCCTCCTCGGCGAGGATGAGGCCGCGCCCAAGAACCGCTTCGCTCTCATCTGCAACGACTGTCGCCTCGTCAAC
GGCCAGGCCCCCCCCGGCACAAAGTCCCTAGCCGAGCTGGGTCCCTGGCGCTGCATGGCCTGCGGTGCCCTGAAC
GAGCATCAACCCGATTCGCTCGTCGACGATGCCGACGTCCGTGGTCGATCCACATCGGCTCGTGACTCTGTTTCC
CCTCCCGTCGTTGACGAAAAGGATCAGAAGCCCGCCGAGGATCCAGTGGCCGATGGCCCGGCCGCGGGTGTCCGG
TCGCGGCGCGCAAAGGCGCAGGCGTCCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail