Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1170
Gene name
LocationContig_145:64..1807
Strand+
Gene length (bp)1743
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.8E-22 55 197
PF00069 Pkinase Protein kinase domain 2.3E-15 328 488
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.2E-10 57 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36616|DSK1_SCHPO Protein kinase dsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsk1 PE=3 SV=2 30 519 2.0E-162
sp|Q03656|SKY1_YEAST Serine/threonine-protein kinase SKY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKY1 PE=1 SV=1 29 250 4.0E-76
sp|Q03656|SKY1_YEAST Serine/threonine-protein kinase SKY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKY1 PE=1 SV=1 324 519 1.0E-75
sp|Q45FA5|SRPK_PHYPO Serine/threonine-protein kinase SRPK OS=Physarum polycephalum PE=1 SV=1 28 492 8.0E-71
sp|Q96SB4|SRPK1_HUMAN SRSF protein kinase 1 OS=Homo sapiens GN=SRPK1 PE=1 SV=2 29 209 4.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36616|DSK1_SCHPO Protein kinase dsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsk1 PE=3 SV=2 30 519 2.0E-162
sp|Q03656|SKY1_YEAST Serine/threonine-protein kinase SKY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKY1 PE=1 SV=1 29 250 4.0E-76
sp|Q03656|SKY1_YEAST Serine/threonine-protein kinase SKY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKY1 PE=1 SV=1 324 519 1.0E-75
sp|Q45FA5|SRPK_PHYPO Serine/threonine-protein kinase SRPK OS=Physarum polycephalum PE=1 SV=1 28 492 8.0E-71
sp|Q96SB4|SRPK1_HUMAN SRSF protein kinase 1 OS=Homo sapiens GN=SRPK1 PE=1 SV=2 29 209 4.0E-64
sp|Q5RD27|SRPK1_PONAB SRSF protein kinase 1 OS=Pongo abelii GN=SRPK1 PE=2 SV=2 29 209 4.0E-64
sp|O54781|SRPK2_MOUSE SRSF protein kinase 2 OS=Mus musculus GN=Srpk2 PE=1 SV=2 245 488 8.0E-64
sp|Q9UPE1|SRPK3_HUMAN SRSF protein kinase 3 OS=Homo sapiens GN=SRPK3 PE=1 SV=2 29 200 1.0E-63
sp|Q9Z0G2|SRPK3_MOUSE SRSF protein kinase 3 OS=Mus musculus GN=Srpk3 PE=1 SV=1 29 201 3.0E-63
sp|P78362|SRPK2_HUMAN SRSF protein kinase 2 OS=Homo sapiens GN=SRPK2 PE=1 SV=3 259 488 3.0E-63
sp|O70551|SRPK1_MOUSE SRSF protein kinase 1 OS=Mus musculus GN=Srpk1 PE=1 SV=2 29 209 8.0E-63
sp|B8Y466|SRPK3_PIG SRSF protein kinase 3 OS=Sus scrofa GN=SRPK3 PE=2 SV=1 29 201 1.0E-62
sp|Q9UPE1|SRPK3_HUMAN SRSF protein kinase 3 OS=Homo sapiens GN=SRPK3 PE=1 SV=2 324 488 1.0E-61
sp|O54781|SRPK2_MOUSE SRSF protein kinase 2 OS=Mus musculus GN=Srpk2 PE=1 SV=2 29 201 6.0E-61
sp|P78362|SRPK2_HUMAN SRSF protein kinase 2 OS=Homo sapiens GN=SRPK2 PE=1 SV=3 29 201 9.0E-61
sp|Q9Z0G2|SRPK3_MOUSE SRSF protein kinase 3 OS=Mus musculus GN=Srpk3 PE=1 SV=1 324 488 2.0E-60
sp|B8Y466|SRPK3_PIG SRSF protein kinase 3 OS=Sus scrofa GN=SRPK3 PE=2 SV=1 324 488 3.0E-60
sp|Q96SB4|SRPK1_HUMAN SRSF protein kinase 1 OS=Homo sapiens GN=SRPK1 PE=1 SV=2 326 488 2.0E-58
sp|Q5RD27|SRPK1_PONAB SRSF protein kinase 1 OS=Pongo abelii GN=SRPK1 PE=2 SV=2 326 488 2.0E-58
sp|O70551|SRPK1_MOUSE SRSF protein kinase 1 OS=Mus musculus GN=Srpk1 PE=1 SV=2 326 488 9.0E-58
sp|Q03563|SPK1_CAEEL Serine/threonine-protein kinase spk-1 OS=Caenorhabditis elegans GN=spk-1 PE=2 SV=3 22 199 1.0E-55
sp|Q61IS6|SPK1_CAEBR Serine/threonine-protein kinase spk-1 OS=Caenorhabditis briggsae GN=spk-1 PE=3 SV=2 22 198 2.0E-54
sp|Q03563|SPK1_CAEEL Serine/threonine-protein kinase spk-1 OS=Caenorhabditis elegans GN=spk-1 PE=2 SV=3 326 488 2.0E-50
sp|Q61IS6|SPK1_CAEBR Serine/threonine-protein kinase spk-1 OS=Caenorhabditis briggsae GN=spk-1 PE=3 SV=2 326 488 2.0E-49
sp|Q86A12|SKY1_DICDI Probable serine/threonine-protein kinase sky1 OS=Dictyostelium discoideum GN=sky1 PE=3 SV=1 328 492 3.0E-48
sp|Q86A12|SKY1_DICDI Probable serine/threonine-protein kinase sky1 OS=Dictyostelium discoideum GN=sky1 PE=3 SV=1 26 197 1.0E-47
sp|Q5UQ24|YL205_MIMIV Putative serine/threonine-protein kinase L205 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L205 PE=3 SV=1 53 491 2.0E-43
sp|Q54UA9|CLKA_DICDI Probable serine/threonine-protein kinase clkA OS=Dictyostelium discoideum GN=clkA PE=3 SV=1 41 197 2.0E-23
sp|Q5R814|PRP4B_PONAB Serine/threonine-protein kinase PRP4 homolog OS=Pongo abelii GN=PRPF4B PE=2 SV=1 40 196 7.0E-21
sp|Q5RKH1|PRP4B_RAT Serine/threonine-protein kinase PRP4 homolog OS=Rattus norvegicus GN=Prpf4b PE=1 SV=1 40 196 9.0E-21
sp|Q5ZIU3|DYRK2_CHICK Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Gallus gallus GN=DYRK2 PE=2 SV=1 38 197 1.0E-20
sp|Q61136|PRP4B_MOUSE Serine/threonine-protein kinase PRP4 homolog OS=Mus musculus GN=Prpf4b PE=1 SV=3 40 196 1.0E-20
sp|Q08DZ2|PRP4B_BOVIN Serine/threonine-protein kinase PRP4 homolog OS=Bos taurus GN=PRPF4B PE=2 SV=1 40 196 1.0E-20
sp|P51568|AFC3_ARATH Serine/threonine-protein kinase AFC3 OS=Arabidopsis thaliana GN=AFC3 PE=2 SV=2 54 196 1.0E-20
sp|Q13523|PRP4B_HUMAN Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens GN=PRPF4B PE=1 SV=3 40 196 1.0E-20
sp|Q5U4C9|DYRK2_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus GN=Dyrk2 PE=2 SV=1 38 197 2.0E-20
sp|Q92630|DYRK2_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens GN=DYRK2 PE=1 SV=3 38 197 3.0E-20
sp|P51566|AFC1_ARATH Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2 38 196 7.0E-20
sp|Q07538|PRP4_SCHPO Serine/threonine-protein kinase prp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp4 PE=1 SV=2 28 196 8.0E-20
sp|P51567|AFC2_ARATH Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1 8 204 1.0E-19
sp|Q10156|LKH1_SCHPO Dual specificity protein kinase lkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lkh1 PE=1 SV=3 22 211 1.0E-19
sp|Q922Y0|DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus GN=Dyrk3 PE=1 SV=1 54 197 3.0E-19
sp|Q4V8A3|DYRK3_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Rattus norvegicus GN=Dyrk3 PE=2 SV=1 54 197 3.0E-19
sp|O43781|DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Homo sapiens GN=DYRK3 PE=2 SV=3 54 197 5.0E-19
sp|Q4R6S5|DYRK3_MACFA Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Macaca fascicularis GN=DYRK3 PE=2 SV=1 54 197 6.0E-19
sp|Q9P6P3|PPK15_SCHPO Serine/threonine-protein kinase ppk15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk15 PE=1 SV=1 54 209 7.0E-19
sp|P14680|YAK1_YEAST Dual specificity protein kinase YAK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAK1 PE=1 SV=1 51 200 9.0E-19
sp|Q54QV3|YAKA_DICDI Probable serine/threonine-protein kinase yakA OS=Dictyostelium discoideum GN=yakA PE=1 SV=1 54 197 6.0E-18
sp|P49657|MNB_DROME Serine/threonine-protein kinase minibrain OS=Drosophila melanogaster GN=mnb PE=2 SV=2 26 196 8.0E-18
sp|A8WJR8|MBK2_CAEBR Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis briggsae GN=mbk-2 PE=3 SV=2 54 197 1.0E-17
sp|Q9XTF3|MBK2_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans GN=mbk-2 PE=1 SV=1 54 197 1.0E-17
sp|Q9V3D5|DYRK2_DROME Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster GN=Dyrk2 PE=1 SV=1 54 197 3.0E-17
sp|P49761|CLK3_HUMAN Dual specificity protein kinase CLK3 OS=Homo sapiens GN=CLK3 PE=1 SV=3 38 211 3.0E-17
sp|O35492|CLK3_MOUSE Dual specificity protein kinase CLK3 OS=Mus musculus GN=Clk3 PE=1 SV=2 38 211 5.0E-17
sp|Q54WE5|PRP4B_DICDI Serine/threonine-protein kinase prpf4B OS=Dictyostelium discoideum GN=prpf4B PE=3 SV=1 17 196 5.0E-17
sp|Q63117|CLK3_RAT Dual specificity protein kinase CLK3 OS=Rattus norvegicus GN=Clk3 PE=1 SV=2 38 204 2.0E-16
sp|Q9NR20|DYRK4_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens GN=DYRK4 PE=1 SV=2 54 196 2.0E-16
sp|Q3SX21|CLK3_BOVIN Dual specificity protein kinase CLK3 OS=Bos taurus GN=CLK3 PE=2 SV=1 38 204 2.0E-16
sp|P49759|CLK1_HUMAN Dual specificity protein kinase CLK1 OS=Homo sapiens GN=CLK1 PE=1 SV=2 2 212 2.0E-16
sp|Q09690|POM1_SCHPO Dual specificity protein kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pom1 PE=1 SV=1 27 196 2.0E-16
sp|P83102|DYRK3_DROME Putative dual specificity tyrosine-phosphorylation-regulated kinase 3 homolog OS=Drosophila melanogaster GN=Dyrk3 PE=1 SV=3 54 197 3.0E-16
sp|Q09815|PPK5_SCHPO Serine/threonine-protein kinase ppk5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk5 PE=1 SV=1 54 196 4.0E-16
sp|Q76NV1|DYRK1_DICDI Probable serine/threonine-protein kinase dyrk1 OS=Dictyostelium discoideum GN=dyrk1 PE=3 SV=1 44 196 6.0E-16
sp|A8X4H1|MBK1_CAEBR Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis briggsae GN=mbk-1 PE=3 SV=2 18 204 1.0E-15
sp|Q8SQZ4|YAK1_ENCCU Probable dual specificity protein kinase YAK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=YAK1 PE=3 SV=1 23 204 1.0E-15
sp|P22518|CLK1_MOUSE Dual specificity protein kinase CLK1 OS=Mus musculus GN=Clk1 PE=1 SV=2 2 212 1.0E-15
sp|P49762|DOA_DROME Serine/threonine-protein kinase Doa OS=Drosophila melanogaster GN=Doa PE=1 SV=2 54 228 1.0E-15
sp|Q8WQL7|MBK1_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis elegans GN=mbk-1 PE=1 SV=1 47 204 2.0E-15
sp|Q9HAZ1|CLK4_HUMAN Dual specificity protein kinase CLK4 OS=Homo sapiens GN=CLK4 PE=1 SV=1 14 200 3.0E-15
sp|Q0IJ08|DYR1A_XENTR Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Xenopus tropicalis GN=dyrk1a PE=2 SV=1 44 196 3.0E-15
sp|Q13627|DYR1A_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens GN=DYRK1A PE=1 SV=2 44 196 3.0E-15
sp|O35493|CLK4_MOUSE Dual specificity protein kinase CLK4 OS=Mus musculus GN=Clk4 PE=1 SV=1 10 200 3.0E-15
sp|Q63470|DYR1A_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Rattus norvegicus GN=Dyrk1a PE=1 SV=2 44 196 3.0E-15
sp|Q91727|CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis GN=cdk4 PE=1 SV=1 53 199 3.0E-15
sp|Q61214|DYR1A_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Mus musculus GN=Dyrk1a PE=1 SV=1 44 196 3.0E-15
sp|Q2TAE3|DYR1A_XENLA Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Xenopus laevis GN=dyrk1a PE=2 SV=1 44 196 3.0E-15
sp|Q8BI55|DYRK4_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Mus musculus GN=Dyrk4 PE=2 SV=1 54 196 5.0E-15
sp|Q8SQZ4|YAK1_ENCCU Probable dual specificity protein kinase YAK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=YAK1 PE=3 SV=1 323 489 6.0E-15
sp|O35491|CLK2_MOUSE Dual specificity protein kinase CLK2 OS=Mus musculus GN=Clk2 PE=1 SV=2 54 202 8.0E-15
sp|P49760|CLK2_HUMAN Dual specificity protein kinase CLK2 OS=Homo sapiens GN=CLK2 PE=1 SV=1 54 202 1.0E-14
sp|Q9Z188|DYR1B_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus GN=Dyrk1b PE=1 SV=3 10 196 2.0E-14
sp|Q9Y463|DYR1B_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens GN=DYRK1B PE=1 SV=1 26 196 2.0E-14
sp|P32350|KNS1_YEAST Dual specificity protein kinase KNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KNS1 PE=1 SV=2 38 196 2.0E-14
sp|Q9V3D5|DYRK2_DROME Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster GN=Dyrk2 PE=1 SV=1 327 489 6.0E-14
sp|Q922Y0|DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus GN=Dyrk3 PE=1 SV=1 327 430 4.0E-13
sp|O43781|DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Homo sapiens GN=DYRK3 PE=2 SV=3 327 430 5.0E-13
sp|Q54BC9|DYRK2_DICDI Probable serine/threonine-protein kinase dyrk2 OS=Dictyostelium discoideum GN=dyrk2 PE=3 SV=1 54 197 5.0E-13
sp|B2MVY4|CDK4_SHEEP Cyclin-dependent kinase 4 OS=Ovis aries PE=2 SV=1 54 199 5.0E-13
sp|Q32KY4|CDK4_BOVIN Cyclin-dependent kinase 4 OS=Bos taurus GN=CDK4 PE=2 SV=1 54 199 5.0E-13
sp|P79432|CDK4_PIG Cyclin-dependent kinase 4 OS=Sus scrofa GN=CDK4 PE=3 SV=1 54 199 5.0E-13
sp|Q4R6S5|DYRK3_MACFA Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Macaca fascicularis GN=DYRK3 PE=2 SV=1 327 430 7.0E-13
sp|Q54BC9|DYRK2_DICDI Probable serine/threonine-protein kinase dyrk2 OS=Dictyostelium discoideum GN=dyrk2 PE=3 SV=1 328 488 8.0E-13
sp|Q4V8A3|DYRK3_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Rattus norvegicus GN=Dyrk3 PE=2 SV=1 327 430 9.0E-13
sp|Q54QV3|YAKA_DICDI Probable serine/threonine-protein kinase yakA OS=Dictyostelium discoideum GN=yakA PE=1 SV=1 327 428 9.0E-13
sp|Q09815|PPK5_SCHPO Serine/threonine-protein kinase ppk5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk5 PE=1 SV=1 328 488 9.0E-13
sp|Q9XTF3|MBK2_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans GN=mbk-2 PE=1 SV=1 328 433 1.0E-12
sp|Q8MQ70|HIPK_CAEEL Homeodomain-interacting protein kinase 1 OS=Caenorhabditis elegans GN=hpk-1 PE=2 SV=1 53 214 1.0E-12
sp|P35426|CDK4_RAT Cyclin-dependent kinase 4 OS=Rattus norvegicus GN=Cdk4 PE=1 SV=1 54 196 1.0E-12
sp|Q86Z02|HIPK1_HUMAN Homeodomain-interacting protein kinase 1 OS=Homo sapiens GN=HIPK1 PE=1 SV=1 55 196 1.0E-12
sp|P30285|CDK4_MOUSE Cyclin-dependent kinase 4 OS=Mus musculus GN=Cdk4 PE=1 SV=1 54 196 1.0E-12
sp|O88904|HIPK1_MOUSE Homeodomain-interacting protein kinase 1 OS=Mus musculus GN=Hipk1 PE=1 SV=2 55 196 1.0E-12
sp|A4L9P5|HIPK1_RAT Homeodomain-interacting protein kinase 1 OS=Rattus norvegicus GN=Hipk1 PE=2 SV=1 55 196 1.0E-12
sp|Q5U4C9|DYRK2_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus GN=Dyrk2 PE=2 SV=1 327 433 2.0E-12
sp|A8WJR8|MBK2_CAEBR Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis briggsae GN=mbk-2 PE=3 SV=2 328 433 2.0E-12
sp|Q9NR20|DYRK4_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens GN=DYRK4 PE=1 SV=2 327 495 2.0E-12
sp|Q8BI55|DYRK4_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Mus musculus GN=Dyrk4 PE=2 SV=1 326 439 2.0E-12
sp|Q3V016|HIPK4_MOUSE Homeodomain-interacting protein kinase 4 OS=Mus musculus GN=Hipk4 PE=1 SV=2 55 196 2.0E-12
sp|Q4V793|HIPK4_RAT Homeodomain-interacting protein kinase 4 OS=Rattus norvegicus GN=Hipk4 PE=2 SV=1 55 196 2.0E-12
sp|Q54UA9|CLKA_DICDI Probable serine/threonine-protein kinase clkA OS=Dictyostelium discoideum GN=clkA PE=3 SV=1 328 491 3.0E-12
sp|P11802|CDK4_HUMAN Cyclin-dependent kinase 4 OS=Homo sapiens GN=CDK4 PE=1 SV=2 54 199 4.0E-12
sp|P83102|DYRK3_DROME Putative dual specificity tyrosine-phosphorylation-regulated kinase 3 homolog OS=Drosophila melanogaster GN=Dyrk3 PE=1 SV=3 328 409 5.0E-12
sp|Q92630|DYRK2_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens GN=DYRK2 PE=1 SV=3 328 433 6.0E-12
sp|Q10156|LKH1_SCHPO Dual specificity protein kinase lkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lkh1 PE=1 SV=3 328 433 6.0E-12
sp|Q9H422|HIPK3_HUMAN Homeodomain-interacting protein kinase 3 OS=Homo sapiens GN=HIPK3 PE=1 SV=1 55 196 7.0E-12
sp|Q9ERH7|HIPK3_MOUSE Homeodomain-interacting protein kinase 3 OS=Mus musculus GN=Hipk3 PE=1 SV=3 55 196 8.0E-12
sp|Q5ZIU3|DYRK2_CHICK Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Gallus gallus GN=DYRK2 PE=2 SV=1 328 433 9.0E-12
sp|O88850|HIPK3_RAT Homeodomain-interacting protein kinase 3 OS=Rattus norvegicus GN=Hipk3 PE=1 SV=1 55 196 9.0E-12
sp|P51568|AFC3_ARATH Serine/threonine-protein kinase AFC3 OS=Arabidopsis thaliana GN=AFC3 PE=2 SV=2 314 491 2.0E-11
sp|Q9Z188|DYR1B_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus GN=Dyrk1b PE=1 SV=3 295 491 2.0E-11
sp|Q9QZR5|HIPK2_MOUSE Homeodomain-interacting protein kinase 2 OS=Mus musculus GN=Hipk2 PE=1 SV=2 55 196 2.0E-11
sp|Q9WUM7|HIPK2_MESAU Homeodomain-interacting protein kinase 2 OS=Mesocricetus auratus GN=Hipk2 PE=1 SV=2 55 196 2.0E-11
sp|Q9H2X6|HIPK2_HUMAN Homeodomain-interacting protein kinase 2 OS=Homo sapiens GN=HIPK2 PE=1 SV=2 55 196 2.0E-11
sp|Q8NE63|HIPK4_HUMAN Homeodomain-interacting protein kinase 4 OS=Homo sapiens GN=HIPK4 PE=1 SV=1 55 196 2.0E-11
sp|Q8WP28|HIPK4_MACFA Homeodomain-interacting protein kinase 4 OS=Macaca fascicularis GN=HIPK4 PE=2 SV=1 55 196 2.0E-11
sp|A2YBX5|G11A_ORYSI Protein kinase G11A OS=Oryza sativa subsp. indica GN=OsI_021818 PE=2 SV=1 55 386 2.0E-11
sp|P51567|AFC2_ARATH Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1 327 432 3.0E-11
sp|Q9Y463|DYR1B_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens GN=DYRK1B PE=1 SV=1 295 491 4.0E-11
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 55 314 5.0E-11
sp|P49657|MNB_DROME Serine/threonine-protein kinase minibrain OS=Drosophila melanogaster GN=mnb PE=2 SV=2 327 428 7.0E-11
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 55 382 8.0E-11
sp|P49760|CLK2_HUMAN Dual specificity protein kinase CLK2 OS=Homo sapiens GN=CLK2 PE=1 SV=1 316 488 9.0E-11
sp|Q0DCT8|G11A_ORYSJ Protein kinase G11A OS=Oryza sativa subsp. japonica GN=Os06g0291600 PE=2 SV=1 55 386 9.0E-11
sp|A8X4H1|MBK1_CAEBR Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis briggsae GN=mbk-1 PE=3 SV=2 328 428 1.0E-10
sp|Q8WQL7|MBK1_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis elegans GN=mbk-1 PE=1 SV=1 328 428 1.0E-10
sp|Q2TAE3|DYR1A_XENLA Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Xenopus laevis GN=dyrk1a PE=2 SV=1 327 465 1.0E-10
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 53 195 1.0E-10
sp|G5EFV5|CDK7_CAEEL Cyclin-dependent kinase 7 OS=Caenorhabditis elegans GN=cdk-7 PE=1 SV=1 54 196 1.0E-10
sp|Q09690|POM1_SCHPO Dual specificity protein kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pom1 PE=1 SV=1 328 488 2.0E-10
sp|P43565|RIM15_YEAST Serine/threonine-protein kinase RIM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM15 PE=1 SV=1 55 197 2.0E-10
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 58 196 2.0E-10
sp|Q0IJ08|DYR1A_XENTR Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Xenopus tropicalis GN=dyrk1a PE=2 SV=1 327 465 3.0E-10
sp|P54736|PKN2_MYXXA Serine/threonine-protein kinase pkn2 OS=Myxococcus xanthus GN=pkn2 PE=3 SV=1 52 196 3.0E-10
sp|O35491|CLK2_MOUSE Dual specificity protein kinase CLK2 OS=Mus musculus GN=Clk2 PE=1 SV=2 316 488 4.0E-10
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 54 196 4.0E-10
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 58 196 4.0E-10
sp|P20911|CDK7_XENLA Cyclin-dependent kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1 54 197 4.0E-10
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 58 196 5.0E-10
sp|P49761|CLK3_HUMAN Dual specificity protein kinase CLK3 OS=Homo sapiens GN=CLK3 PE=1 SV=3 316 477 6.0E-10
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 54 196 6.0E-10
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 58 196 6.0E-10
sp|O35492|CLK3_MOUSE Dual specificity protein kinase CLK3 OS=Mus musculus GN=Clk3 PE=1 SV=2 316 477 7.0E-10
sp|Q3SX21|CLK3_BOVIN Dual specificity protein kinase CLK3 OS=Bos taurus GN=CLK3 PE=2 SV=1 327 488 7.0E-10
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 54 195 7.0E-10
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 58 196 7.0E-10
sp|P0C264|SBK3_HUMAN Uncharacterized serine/threonine-protein kinase SBK3 OS=Homo sapiens GN=SBK3 PE=3 SV=2 54 214 8.0E-10
sp|Q63470|DYR1A_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Rattus norvegicus GN=Dyrk1a PE=1 SV=2 327 465 9.0E-10
sp|Q61214|DYR1A_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Mus musculus GN=Dyrk1a PE=1 SV=1 327 465 9.0E-10
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 54 196 9.0E-10
sp|Q9P6P3|PPK15_SCHPO Serine/threonine-protein kinase ppk15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk15 PE=1 SV=1 328 427 1.0E-09
sp|Q63117|CLK3_RAT Dual specificity protein kinase CLK3 OS=Rattus norvegicus GN=Clk3 PE=1 SV=2 327 488 1.0E-09
sp|Q13627|DYR1A_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens GN=DYRK1A PE=1 SV=2 327 428 1.0E-09
sp|P32581|IME2_YEAST Meiosis induction protein kinase IME2/SME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IME2 PE=3 SV=1 43 218 1.0E-09
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 55 197 1.0E-09
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 58 196 1.0E-09
sp|Q2QM77|PID_ORYSJ Protein kinase PINOID OS=Oryza sativa subsp. japonica GN=PID PE=2 SV=1 55 197 1.0E-09
sp|Q76NV1|DYRK1_DICDI Probable serine/threonine-protein kinase dyrk1 OS=Dictyostelium discoideum GN=dyrk1 PE=3 SV=1 327 428 2.0E-09
sp|Q80YP0|CDK3_MOUSE Cyclin-dependent kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2 58 197 2.0E-09
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 58 196 2.0E-09
sp|P51566|AFC1_ARATH Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2 327 430 3.0E-09
sp|G5EBT1|SMA5_CAEEL Mitogen-activated protein kinase sma-5 OS=Caenorhabditis elegans GN=sma-5 PE=2 SV=1 55 196 3.0E-09
sp|O94547|SRK1_SCHPO Serine/threonine-protein kinase srk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srk1 PE=1 SV=1 54 216 3.0E-09
sp|O64682|PID_ARATH Protein kinase PINOID OS=Arabidopsis thaliana GN=PID PE=1 SV=1 47 196 3.0E-09
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 53 206 3.0E-09
sp|O80345|CDKF1_ARATH Cyclin-dependent kinase F-1 OS=Arabidopsis thaliana GN=CDKF-1 PE=1 SV=1 53 411 3.0E-09
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 53 196 3.0E-09
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 52 196 3.0E-09
sp|Q0J4I1|CKB21_ORYSJ Cyclin-dependent kinase B2-1 OS=Oryza sativa subsp. japonica GN=CDKB2-1 PE=1 SV=1 55 197 4.0E-09
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 54 197 4.0E-09
sp|O74456|PEF1_SCHPO Serine/threonine-protein kinase pef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pef1 PE=3 SV=2 55 196 4.0E-09
sp|Q55CL6|MP2K1_DICDI Dual specificity mitogen-activated protein kinase kinase 1 OS=Dictyostelium discoideum GN=mekA PE=1 SV=1 57 196 5.0E-09
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 52 196 6.0E-09
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 54 246 7.0E-09
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 54 197 7.0E-09
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 46 208 8.0E-09
sp|Q54WE5|PRP4B_DICDI Serine/threonine-protein kinase prpf4B OS=Dictyostelium discoideum GN=prpf4B PE=3 SV=1 327 475 9.0E-09
sp|P49762|DOA_DROME Serine/threonine-protein kinase Doa OS=Drosophila melanogaster GN=Doa PE=1 SV=2 328 415 9.0E-09
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 44 196 9.0E-09
sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=1 SV=3 47 196 9.0E-09
sp|P49759|CLK1_HUMAN Dual specificity protein kinase CLK1 OS=Homo sapiens GN=CLK1 PE=1 SV=2 328 489 1.0E-08
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 54 196 1.0E-08
sp|P51953|CDK7_CARAU Cyclin-dependent kinase 7 OS=Carassius auratus GN=cdk7 PE=2 SV=1 55 197 1.0E-08
sp|O14132|PIT1_SCHPO Sporulation protein kinase pit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pit1 PE=1 SV=1 23 196 1.0E-08
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 55 215 1.0E-08
sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1 39 196 1.0E-08
sp|Q8NU97|PKN2_CORGL Serine/threonine-protein kinases PknA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknA PE=3 SV=1 61 204 1.0E-08
sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1 47 196 1.0E-08
sp|B1WAR9|GWL_XENTR Serine/threonine-protein kinase greatwall OS=Xenopus tropicalis GN=mastl PE=2 SV=1 54 196 1.0E-08
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 18 196 2.0E-08
sp|Q8LF80|CKB21_ARATH Cyclin-dependent kinase B2-1 OS=Arabidopsis thaliana GN=CDKB2-1 PE=1 SV=2 326 492 2.0E-08
sp|Q6NTJ3|GWL_XENLA Serine/threonine-protein kinase greatwall OS=Xenopus laevis GN=mastl PE=1 SV=1 54 196 2.0E-08
sp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1 47 196 2.0E-08
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 49 197 2.0E-08
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 54 196 2.0E-08
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 52 197 2.0E-08
sp|P53778|MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens GN=MAPK12 PE=1 SV=3 328 489 2.0E-08
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 46 196 2.0E-08
sp|O59853|HOG2_ZYGRO Mitogen-activated protein kinase HOG2 OS=Zygosaccharomyces rouxii GN=HOG2 PE=3 SV=1 328 488 2.0E-08
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 58 196 2.0E-08
sp|P22518|CLK1_MOUSE Dual specificity protein kinase CLK1 OS=Mus musculus GN=Clk1 PE=1 SV=2 328 415 3.0E-08
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 37 196 3.0E-08
sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1 55 196 3.0E-08
sp|O04160|KSGT_BRANA Shaggy-related protein kinase theta OS=Brassica napus PE=2 SV=2 51 196 3.0E-08
sp|P38938|CEK1_SCHPO Serine/threonine-protein kinase cek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cek1 PE=1 SV=3 55 390 3.0E-08
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 44 196 3.0E-08
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 44 196 3.0E-08
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 44 196 3.0E-08
sp|Q9HAZ1|CLK4_HUMAN Dual specificity protein kinase CLK4 OS=Homo sapiens GN=CLK4 PE=1 SV=1 306 415 4.0E-08
sp|P67963|KC1A_XENLA Casein kinase I isoform alpha OS=Xenopus laevis GN=csnk1a1 PE=2 SV=1 53 226 4.0E-08
sp|P67962|KC1A_CHICK Casein kinase I isoform alpha OS=Gallus gallus GN=CSNK1A1 PE=2 SV=1 53 226 4.0E-08
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 54 196 4.0E-08
sp|P67829|KC1A_SHEEP Casein kinase I isoform alpha OS=Ovis aries GN=CSNK1A1 PE=3 SV=1 53 226 4.0E-08
sp|P67828|KC1A_RABIT Casein kinase I isoform alpha OS=Oryctolagus cuniculus GN=CSNK1A1 PE=1 SV=1 53 226 4.0E-08
sp|P67827|KC1A_BOVIN Casein kinase I isoform alpha OS=Bos taurus GN=CSNK1A1 PE=1 SV=1 53 226 4.0E-08
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 55 222 4.0E-08
sp|Q8LG64|CKB22_ARATH Cyclin-dependent kinase B2-2 OS=Arabidopsis thaliana GN=CDKB2-2 PE=1 SV=2 326 492 4.0E-08
sp|Q8BK63|KC1A_MOUSE Casein kinase I isoform alpha OS=Mus musculus GN=Csnk1a1 PE=1 SV=2 53 226 4.0E-08
sp|P48729|KC1A_HUMAN Casein kinase I isoform alpha OS=Homo sapiens GN=CSNK1A1 PE=1 SV=2 53 226 4.0E-08
sp|P97633|KC1A_RAT Casein kinase I isoform alpha OS=Rattus norvegicus GN=Csnk1a1 PE=2 SV=1 53 226 4.0E-08
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 53 206 5.0E-08
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 53 205 5.0E-08
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 55 222 5.0E-08
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 55 222 5.0E-08
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 54 246 5.0E-08
sp|Q9UV50|HOG1_DEBHA Mitogen-activated protein kinase HOG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HOG1 PE=1 SV=3 328 489 5.0E-08
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 54 246 5.0E-08
sp|P0C5K0|SBK3_MOUSE Uncharacterized serine/threonine-protein kinase SBK3 OS=Mus musculus GN=Sbk3 PE=3 SV=2 54 204 5.0E-08
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 58 202 6.0E-08
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 49 197 6.0E-08
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 54 196 6.0E-08
sp|A3LN91|HOG1_PICST Mitogen-activated protein kinase HOG1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HOG1 PE=3 SV=2 328 489 6.0E-08
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 53 205 6.0E-08
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 52 245 6.0E-08
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 18 196 6.0E-08
sp|O35493|CLK4_MOUSE Dual specificity protein kinase CLK4 OS=Mus musculus GN=Clk4 PE=1 SV=1 306 412 7.0E-08
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 55 197 7.0E-08
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 51 197 7.0E-08
sp|Q05999|D6KL3_ARATH Serine/threonine-protein kinase D6PKL3 OS=Arabidopsis thaliana GN=D6PKL3 PE=1 SV=1 45 196 7.0E-08
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 44 208 7.0E-08
sp|Q39010|KSG6_ARATH Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=2 SV=2 20 197 7.0E-08
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 32 196 7.0E-08
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 55 196 7.0E-08
sp|Q6DBX4|GWL_DANRE Serine/threonine-protein kinase greatwall OS=Danio rerio GN=mastl PE=2 SV=1 55 196 7.0E-08
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 55 196 7.0E-08
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 55 196 8.0E-08
sp|Q13523|PRP4B_HUMAN Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens GN=PRPF4B PE=1 SV=3 328 428 1.0E-07
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2 55 196 1.0E-07
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 50 197 1.0E-07
sp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1 58 196 1.0E-07
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 54 196 1.0E-07
sp|Q17446|PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans GN=pmk-1 PE=1 SV=1 328 514 1.0E-07
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 52 197 1.0E-07
sp|Q69ZA1|CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus GN=Cdk13 PE=1 SV=3 54 196 1.0E-07
sp|Q14004|CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2 54 196 1.0E-07
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 27 196 1.0E-07
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 55 208 1.0E-07
sp|Q6I5Y0|CDKC1_ORYSJ Cyclin-dependent kinase C-1 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=2 SV=1 55 197 1.0E-07
sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus GN=CDK13 PE=3 SV=1 54 196 1.0E-07
sp|O42844|KCC2_SCHPO Calcium/calmodulin-dependent protein kinase type II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk2 PE=1 SV=1 54 197 1.0E-07
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 53 197 1.0E-07
sp|Q9LUL2|WAG2_ARATH Serine/threonine-protein kinase WAG2 OS=Arabidopsis thaliana GN=WAG2 PE=2 SV=1 57 196 1.0E-07
sp|Q5R814|PRP4B_PONAB Serine/threonine-protein kinase PRP4 homolog OS=Pongo abelii GN=PRPF4B PE=2 SV=1 328 427 2.0E-07
sp|Q5RKH1|PRP4B_RAT Serine/threonine-protein kinase PRP4 homolog OS=Rattus norvegicus GN=Prpf4b PE=1 SV=1 328 428 2.0E-07
sp|Q61136|PRP4B_MOUSE Serine/threonine-protein kinase PRP4 homolog OS=Mus musculus GN=Prpf4b PE=1 SV=3 328 428 2.0E-07
sp|Q08DZ2|PRP4B_BOVIN Serine/threonine-protein kinase PRP4 homolog OS=Bos taurus GN=PRPF4B PE=2 SV=1 328 428 2.0E-07
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 54 198 2.0E-07
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 328 489 2.0E-07
sp|Q39011|KSG7_ARATH Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2 47 206 2.0E-07
sp|Q61RA2|CHK1_CAEBR Serine/threonine-protein kinase chk-1 OS=Caenorhabditis briggsae GN=chk-1 PE=3 SV=1 55 239 2.0E-07
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 52 196 2.0E-07
sp|Q8SRI3|MRK1_ENCCU Probable serine/threonine-protein kinase MRK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MRK1 PE=3 SV=2 51 224 2.0E-07
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 53 197 2.0E-07
sp|Q9KIG4|PK1_STRTO Serine/threonine-protein kinase PK-1 OS=Streptomyces toyocaensis GN=spk1 PE=1 SV=1 52 196 2.0E-07
sp|Q03957|CTK1_YEAST CTD kinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTK1 PE=1 SV=1 55 197 2.0E-07
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 61 196 2.0E-07
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 48 208 2.0E-07
sp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3 51 196 2.0E-07
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 54 200 2.0E-07
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 53 197 3.0E-07
sp|F4I4F2|RHS3_ARATH Serine/threonine-protein kinase RHS3 OS=Arabidopsis thaliana GN=RHS3 PE=1 SV=1 47 196 3.0E-07
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 61 196 3.0E-07
sp|Q8L4P8|CKB11_ORYSJ Cyclin-dependent kinase B1-1 OS=Oryza sativa subsp. japonica GN=CDKB1-1 PE=2 SV=1 54 197 3.0E-07
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 328 489 3.0E-07
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 43 196 3.0E-07
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 53 197 3.0E-07
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 328 488 3.0E-07
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 55 196 3.0E-07
sp|Q750A9|HOG1_ASHGO Mitogen-activated protein kinase HOG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HOG1 PE=3 SV=2 328 488 3.0E-07
sp|P32350|KNS1_YEAST Dual specificity protein kinase KNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KNS1 PE=1 SV=2 328 386 4.0E-07
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 52 196 4.0E-07
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 27 196 4.0E-07
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 51 197 4.0E-07
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 51 197 4.0E-07
sp|A2Y4B6|CDKD1_ORYSI Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. indica GN=CDKD-1 PE=2 SV=1 54 196 4.0E-07
sp|Q14AX6|CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus GN=Cdk12 PE=1 SV=2 54 196 4.0E-07
sp|Q3MJK5|CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus GN=Cdk12 PE=1 SV=1 54 196 4.0E-07
sp|Q8W4P1|CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana GN=CDKC-2 PE=1 SV=2 55 197 5.0E-07
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 53 202 5.0E-07
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 343 490 5.0E-07
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 44 197 5.0E-07
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 55 204 5.0E-07
sp|Q6DJM7|CDK14_XENLA Cyclin-dependent kinase 14 OS=Xenopus laevis GN=cdk14 PE=2 SV=1 22 196 5.0E-07
sp|C0RW22|CDK14_DASNO Cyclin-dependent kinase 14 OS=Dasypus novemcinctus GN=CDK14 PE=3 SV=1 51 196 5.0E-07
sp|O94921|CDK14_HUMAN Cyclin-dependent kinase 14 OS=Homo sapiens GN=CDK14 PE=1 SV=3 51 196 5.0E-07
sp|O35495|CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus GN=Cdk14 PE=1 SV=2 51 196 5.0E-07
sp|B0VXL7|CDK14_CALMO Cyclin-dependent kinase 14 OS=Callicebus moloch GN=CDK14 PE=3 SV=1 51 196 5.0E-07
sp|P29620|CDKD1_ORYSJ Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. japonica GN=CDKD-1 PE=1 SV=1 54 196 5.0E-07
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 54 196 6.0E-07
sp|B6A7Q3|CDK14_RABIT Cyclin-dependent kinase 14 OS=Oryctolagus cuniculus GN=CDK14 PE=3 SV=1 51 196 6.0E-07
sp|B0VXE8|CDK14_CALJA Cyclin-dependent kinase 14 OS=Callithrix jacchus GN=CDK14 PE=3 SV=1 51 196 6.0E-07
sp|Q9LFT8|CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana GN=CDKC-1 PE=1 SV=1 55 197 6.0E-07
sp|Q5RCY1|UHMK1_PONAB Serine/threonine-protein kinase Kist OS=Pongo abelii GN=UHMK1 PE=2 SV=1 115 221 6.0E-07
sp|Q8TAS1|UHMK1_HUMAN Serine/threonine-protein kinase Kist OS=Homo sapiens GN=UHMK1 PE=1 SV=2 115 221 6.0E-07
sp|P21965|MCK1_YEAST Protein kinase MCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCK1 PE=1 SV=1 59 197 6.0E-07
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 55 195 6.0E-07
sp|P32944|SWE1_YEAST Mitosis inhibitor protein kinase SWE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWE1 PE=1 SV=1 54 196 6.0E-07
sp|E1BB50|CDK12_BOVIN Cyclin-dependent kinase 12 OS=Bos taurus GN=CDK12 PE=3 SV=1 54 196 6.0E-07
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 49 195 6.0E-07
sp|Q8WTQ7|GRK7_HUMAN G protein-coupled receptor kinase 7 OS=Homo sapiens GN=GRK7 PE=1 SV=1 52 197 7.0E-07
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 53 197 7.0E-07
sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 52 198 7.0E-07
sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 52 215 7.0E-07
sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 52 198 7.0E-07
sp|Q63285|UHMK1_RAT Serine/threonine-protein kinase Kist OS=Rattus norvegicus GN=Uhmk1 PE=1 SV=1 115 221 7.0E-07
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 55 196 7.0E-07
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 54 200 7.0E-07
sp|D2H526|CDK12_AILME Cyclin-dependent kinase 12 OS=Ailuropoda melanoleuca GN=CDK12 PE=3 SV=1 54 196 7.0E-07
sp|P97343|UHMK1_MOUSE Serine/threonine-protein kinase Kist OS=Mus musculus GN=Uhmk1 PE=1 SV=3 115 221 7.0E-07
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 20 200 8.0E-07
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 51 197 8.0E-07
sp|Q9P419|HOG1_EMENI Mitogen-activated protein kinase hog1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hog1 PE=1 SV=1 53 196 8.0E-07
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 55 195 8.0E-07
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 53 197 8.0E-07
sp|Q38HL5|HOG1_EURHE Mitogen-activated protein kinase hog1 OS=Eurotium herbariorum GN=hog1 PE=3 SV=1 54 196 8.0E-07
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 55 196 8.0E-07
sp|Q96RG2|PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3 54 196 8.0E-07
sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 52 215 9.0E-07
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 54 196 9.0E-07
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 54 196 1.0E-06
sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 52 198 1.0E-06
sp|A4IIW7|CDK14_XENTR Cyclin-dependent kinase 14 OS=Xenopus tropicalis GN=cdk14 PE=2 SV=1 51 196 1.0E-06
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 54 196 1.0E-06
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 52 202 1.0E-06
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 52 202 1.0E-06
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 49 195 1.0E-06
sp|Q39012|KSG9_ARATH Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1 47 197 1.0E-06
sp|Q52PH6|HOG1_ALTBR Mitogen-activated protein kinase HOG1 OS=Alternaria brassicicola GN=HOG1 PE=3 SV=1 53 196 1.0E-06
sp|P54367|KC1A_DROME Casein kinase I isoform alpha OS=Drosophila melanogaster GN=CkIalpha PE=1 SV=1 53 199 1.0E-06
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 55 196 1.0E-06
sp|Q54QB1|ERK2_DICDI Extracellular signal-regulated kinase 2 OS=Dictyostelium discoideum GN=erkB PE=1 SV=1 54 196 1.0E-06
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 54 196 1.0E-06
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 55 196 1.0E-06
sp|Q751E8|PHO85_ASHGO Negative regulator of the PHO system OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PHO85 PE=3 SV=2 54 196 1.0E-06
sp|B5DE93|CDK12_XENTR Cyclin-dependent kinase 12 OS=Xenopus tropicalis GN=cdk12 PE=2 SV=1 54 196 1.0E-06
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 53 196 1.0E-06
sp|Q9C8M5|WAG1_ARATH Serine/threonine-protein kinase WAG1 OS=Arabidopsis thaliana GN=WAG1 PE=2 SV=1 55 196 1.0E-06
sp|Q556Y4|KC1_DICDI Casein kinase I OS=Dictyostelium discoideum GN=cak1-1 PE=1 SV=1 53 208 1.0E-06
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 53 196 1.0E-06
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 53 196 1.0E-06
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 53 196 1.0E-06
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 55 196 1.0E-06
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 55 197 2.0E-06
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 57 196 2.0E-06
sp|A3EZ55|HOG1A_WALI9 Mitogen-activated protein kinase HOG1A OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1A PE=1 SV=2 54 196 2.0E-06
sp|Q388M1|GSK3B_TRYB2 Glycogen synthase kinase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=GSK3 PE=1 SV=1 54 197 2.0E-06
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 53 196 2.0E-06
sp|P42168|KC1A_CAEEL Casein kinase I isoform alpha OS=Caenorhabditis elegans GN=kin-19 PE=3 SV=1 54 225 2.0E-06
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 49 197 2.0E-06
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 52 202 2.0E-06
sp|Q9NYV4|CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=2 54 196 2.0E-06
sp|A1IVT7|HOG1_BOTFB Mitogen-activated protein kinase hog1 OS=Botryotinia fuckeliana (strain B05.10) GN=hog1 PE=1 SV=1 53 196 2.0E-06
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 53 203 2.0E-06
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 53 196 2.0E-06
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 55 195 2.0E-06
sp|Q9UV51|HOG1_MAGO7 Mitogen-activated protein kinase HOG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HOG1 PE=3 SV=1 53 196 2.0E-06
sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1 55 196 2.0E-06
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 54 206 2.0E-06
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 54 196 2.0E-06
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 55 230 2.0E-06
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 53 196 2.0E-06
sp|Q7T2E3|KC1DA_DANRE Casein kinase I isoform delta-A OS=Danio rerio GN=csnk1da PE=2 SV=1 54 223 3.0E-06
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 55 197 3.0E-06
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 55 197 3.0E-06
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 55 197 3.0E-06
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 48 197 3.0E-06
sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homolog MsK-2 OS=Medicago sativa GN=MSK-2 PE=2 SV=1 47 196 3.0E-06
sp|Q6PWX2|HOG1_BEABA Mitogen-activated protein kinase HOG1 OS=Beauveria bassiana GN=HOG1 PE=3 SV=1 53 196 3.0E-06
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 55 195 3.0E-06
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 55 197 3.0E-06
sp|Q7ZX42|CDK9B_XENLA Cyclin-dependent kinase 9-B OS=Xenopus laevis GN=cdk9-b PE=2 SV=1 54 196 3.0E-06
sp|Q2H332|HOG1_CHAGB Mitogen-activated protein kinase HOG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HOG1 PE=3 SV=1 53 196 3.0E-06
sp|Q875L0|HOG1_CRYPA Mitogen-activated protein kinase HOG1 OS=Cryphonectria parasitica GN=HOG1 PE=1 SV=1 53 196 3.0E-06
sp|P0C431|HOG1_GIBZE Mitogen-activated protein kinase HOG1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HOG1 PE=3 SV=1 53 196 3.0E-06
sp|Q8LF80|CKB21_ARATH Cyclin-dependent kinase B2-1 OS=Arabidopsis thaliana GN=CDKB2-1 PE=1 SV=2 58 197 4.0E-06
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 54 197 4.0E-06
sp|Q8WQ99|KC1G_CAEEL Casein kinase I gamma OS=Caenorhabditis elegans GN=csnk-1 PE=3 SV=1 44 196 4.0E-06
sp|Q75Q66|HOG1_COLOR Mitogen-activated protein kinase HOG1 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=HOG1 PE=3 SV=1 53 196 4.0E-06
sp|Q0D0P5|HOG1_ASPTN Mitogen-activated protein kinase hog1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hog1 PE=3 SV=2 53 196 4.0E-06
sp|Q2WGK3|HOG1_TRIHA Mitogen-activated protein kinase hog1 OS=Trichoderma harzianum GN=hog1 PE=1 SV=1 53 196 4.0E-06
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 53 197 4.0E-06
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 54 196 4.0E-06
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 54 215 4.0E-06
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 49 197 5.0E-06
sp|Q39019|KSG10_ARATH Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=2 SV=2 27 196 5.0E-06
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 53 196 5.0E-06
sp|Q9YGW0|MKNK1_XENLA MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus laevis GN=mknk1 PE=2 SV=2 49 214 5.0E-06
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 55 197 5.0E-06
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 53 196 5.0E-06
sp|Q5BP74|KC1D_XENLA Casein kinase I isoform delta OS=Xenopus laevis GN=csnk1d PE=1 SV=2 54 223 5.0E-06
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 49 195 5.0E-06
sp|Q04770|CDK2_ENTHI Cell division protein kinase 2 homolog OS=Entamoeba histolytica GN=CDC2 PE=3 SV=1 54 196 5.0E-06
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 54 197 6.0E-06
sp|Q0CIC7|MPKC_ASPTN Mitogen-activated protein kinase mpkC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mpkC PE=3 SV=2 46 196 6.0E-06
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 54 197 6.0E-06
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 53 196 6.0E-06
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 53 205 6.0E-06
sp|O23145|KSG2_ARATH Shaggy-related protein kinase beta OS=Arabidopsis thaliana GN=ASK2 PE=2 SV=1 48 196 6.0E-06
sp|P35507|KC1B_BOVIN Casein kinase I isoform beta OS=Bos taurus GN=CSNK1B PE=2 SV=1 53 223 6.0E-06
sp|Q06309|CRK1_LEIME Cell division protein kinase 2 homolog CRK1 OS=Leishmania mexicana GN=CRK1 PE=2 SV=1 54 196 6.0E-06
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 55 196 6.0E-06
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 328 490 7.0E-06
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 54 197 7.0E-06
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 53 196 7.0E-06
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 52 199 7.0E-06
sp|Q2U469|MPKC_ASPOR Mitogen-activated protein kinase mpkC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpkC PE=3 SV=2 46 196 7.0E-06
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 55 244 8.0E-06
sp|Q2V419|CKB12_ARATH Cyclin-dependent kinase B1-2 OS=Arabidopsis thaliana GN=CDKB1-2 PE=1 SV=2 54 197 8.0E-06
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 55 197 1.0E-05
sp|Q96TL5|HOG1_NEUCR Mitogen-activated protein kinase hog-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hog-1 PE=1 SV=1 53 196 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1170
MHRSHHLSGAMAASPSASSVDDPSENTADEEDSEDYCKGGYHPVQIGEKFKDGKYTVVRKLGWGHFSTVWLSRDN
TNSKHVALKVVRSAAHYTETAIDEIKLLSKIVQAKPDHPGRKHVVSLLDSFEHKGPNGTHVCMVFEVLGENLLGL
IKRWNHRGIPMPLVKQITKQVLLGLDYLHRECGIIHTDLKPENVLIEIGDVEQIVKKVVKNDVGDKENNRNGRRR
RRTLITGSQPLPSPLNSTFNQSNLFPSPGSQPSLAGVLGQASGGSKESPQKSPDESQKQREKSADVLSREVSGIS
LDKSSSSSVSTGEKRKAEDSHSFDIISVKIADLGNACWVNHHFTNDIQTRQYRSPEVILGSKWGASTDVWSMAAM
VFELITGDYLFDPQSGTKYGKDDDHIAQIIELVGSFPRSLCLSGKWSQEIFNRKGELRNIHRLRHWALPDVLREK
YHFKEDEAKRISNFLSPMLELVPEKRANAGGMAGHGWLEDTPGMKGLRIDGLEVGGRGEGIDGWATEVRKR*
Coding >Ophun1|1170
ATGCACAGGTCACATCACTTGTCGGGCGCCATGGCTGCCTCGCCCTCAGCCTCGTCCGTCGACGACCCTTCCGAG
AATACGGCAGACGAGGAGGACTCGGAGGACTATTGCAAAGGCGGCTACCACCCTGTCCAGATCGGCGAAAAGTTC
AAGGACGGCAAGTACACCGTCGTCCGCAAGCTGGGCTGGGGCCACTTCTCCACCGTCTGGCTCTCGCGCGACAAT
ACCAACAGCAAGCACGTCGCCCTCAAGGTCGTCCGCTCCGCCGCACACTACACCGAGACGGCCATCGACGAGATC
AAGCTTCTTAGTAAGATTGTTCAGGCCAAGCCCGATCATCCCGGCCGCAAACATGTCGTCAGCCTTCTCGATTCT
TTCGAGCACAAGGGCCCGAATGGCACCCACGTCTGCATGGTGTTTGAAGTTTTGGGCGAGAACCTGCTCGGTCTT
ATCAAGCGATGGAATCACCGCGGCATTCCCATGCCCCTCGTGAAGCAAATCACCAAACAGGTTCTTCTCGGCCTC
GACTACCTCCATCGCGAGTGCGGCATCATCCACACCGATCTCAAGCCCGAGAACGTTCTCATTGAGATCGGCGAC
GTCGAGCAGATCGTCAAGAAGGTTGTCAAGAACGACGTTGGCGATAAGGAGAACAACCGAAATGGCCGTCGGCGG
AGGAGGACCCTCATTACCGGCAGCCAGCCCCTACCCTCGCCTCTGAACTCGACCTTTAACCAATCCAACCTGTTT
CCTTCGCCGGGCTCTCAGCCCAGTCTCGCCGGCGTCCTTGGTCAAGCCTCGGGTGGTTCTAAGGAATCTCCGCAA
AAGTCACCCGACGAGTCGCAGAAGCAGAGGGAGAAGTCGGCCGATGTCTTGAGCCGTGAGGTTTCCGGCATTTCG
CTCGACAAATCTAGCAGCTCATCCGTCTCGACCGGCGAAAAGCGCAAGGCCGAAGATTCGCACTCCTTTGATATT
ATCAGTGTCAAGATTGCCGATCTCGGCAACGCCTGCTGGGTCAATCATCACTTCACCAACGACATCCAGACCAGG
CAATATCGCTCGCCCGAGGTTATCCTCGGCTCCAAGTGGGGTGCCAGCACCGACGTCTGGAGCATGGCAGCAATG
GTGTTCGAGTTGATTACGGGCGATTACCTCTTCGACCCGCAGTCGGGCACGAAATACGGTAAAGACGACGATCAC
ATCGCCCAGATTATCGAACTGGTTGGCTCGTTTCCGCGATCGCTGTGCTTGAGCGGCAAGTGGAGCCAGGAGATT
TTCAACCGGAAGGGCGAGCTGCGTAACATACACCGGTTGCGACACTGGGCGCTGCCCGACGTGCTCCGAGAAAAA
TACCACTTCAAGGAGGACGAGGCGAAGCGCATCTCAAACTTCTTGTCGCCGATGCTAGAGCTCGTACCTGAAAAG
AGGGCCAACGCGGGGGGCATGGCGGGTCACGGCTGGCTAGAAGACACGCCAGGTATGAAGGGGCTCAGGATCGAT
GGCCTCGAGGTTGGAGGCCGCGGAGAAGGCATCGACGGCTGGGCGACGGAAGTGAGGAAACGATGA
Transcript >Ophun1|1170
ATGCACAGGTCACATCACTTGTCGGGCGCCATGGCTGCCTCGCCCTCAGCCTCGTCCGTCGACGACCCTTCCGAG
AATACGGCAGACGAGGAGGACTCGGAGGACTATTGCAAAGGCGGCTACCACCCTGTCCAGATCGGCGAAAAGTTC
AAGGACGGCAAGTACACCGTCGTCCGCAAGCTGGGCTGGGGCCACTTCTCCACCGTCTGGCTCTCGCGCGACAAT
ACCAACAGCAAGCACGTCGCCCTCAAGGTCGTCCGCTCCGCCGCACACTACACCGAGACGGCCATCGACGAGATC
AAGCTTCTTAGTAAGATTGTTCAGGCCAAGCCCGATCATCCCGGCCGCAAACATGTCGTCAGCCTTCTCGATTCT
TTCGAGCACAAGGGCCCGAATGGCACCCACGTCTGCATGGTGTTTGAAGTTTTGGGCGAGAACCTGCTCGGTCTT
ATCAAGCGATGGAATCACCGCGGCATTCCCATGCCCCTCGTGAAGCAAATCACCAAACAGGTTCTTCTCGGCCTC
GACTACCTCCATCGCGAGTGCGGCATCATCCACACCGATCTCAAGCCCGAGAACGTTCTCATTGAGATCGGCGAC
GTCGAGCAGATCGTCAAGAAGGTTGTCAAGAACGACGTTGGCGATAAGGAGAACAACCGAAATGGCCGTCGGCGG
AGGAGGACCCTCATTACCGGCAGCCAGCCCCTACCCTCGCCTCTGAACTCGACCTTTAACCAATCCAACCTGTTT
CCTTCGCCGGGCTCTCAGCCCAGTCTCGCCGGCGTCCTTGGTCAAGCCTCGGGTGGTTCTAAGGAATCTCCGCAA
AAGTCACCCGACGAGTCGCAGAAGCAGAGGGAGAAGTCGGCCGATGTCTTGAGCCGTGAGGTTTCCGGCATTTCG
CTCGACAAATCTAGCAGCTCATCCGTCTCGACCGGCGAAAAGCGCAAGGCCGAAGATTCGCACTCCTTTGATATT
ATCAGTGTCAAGATTGCCGATCTCGGCAACGCCTGCTGGGTCAATCATCACTTCACCAACGACATCCAGACCAGG
CAATATCGCTCGCCCGAGGTTATCCTCGGCTCCAAGTGGGGTGCCAGCACCGACGTCTGGAGCATGGCAGCAATG
GTGTTCGAGTTGATTACGGGCGATTACCTCTTCGACCCGCAGTCGGGCACGAAATACGGTAAAGACGACGATCAC
ATCGCCCAGATTATCGAACTGGTTGGCTCGTTTCCGCGATCGCTGTGCTTGAGCGGCAAGTGGAGCCAGGAGATT
TTCAACCGGAAGGGCGAGCTGCGTAACATACACCGGTTGCGACACTGGGCGCTGCCCGACGTGCTCCGAGAAAAA
TACCACTTCAAGGAGGACGAGGCGAAGCGCATCTCAAACTTCTTGTCGCCGATGCTAGAGCTCGTACCTGAAAAG
AGGGCCAACGCGGGGGGCATGGCGGGTCACGGCTGGCTAGAAGACACGCCAGGTATGAAGGGGCTCAGGATCGAT
GGCCTCGAGGTTGGAGGCCGCGGAGAAGGCATCGACGGCTGGGCGACGGAAGTGAGGAAACGATGA
Gene >Ophun1|1170
ATGCACAGGTCACATCACTTGTCGGGCGCCATGGCTGCCTCGCCCTCAGCCTCGTCCGTCGACGACCCTTCCGAG
AATACGGCAGACGAGGAGGACTCGGAGGACTATTGCAAAGGCGGCTACCACCCTGTCCAGATCGGCGAAAAGTTC
AAGGACGGCAAGTACACCGTCGTCCGCAAGCTGGGCTGGGGCCACTTCTCCACCGTCTGGCTCTCGCGCGACAAT
ACCAACAGCAAGCACGTCGCCCTCAAGGTCGTCCGCTCCGCCGCACACTACACCGAGACGGCCATCGACGAGATC
AAGCTTCTTAGTAAGATTGTTCAGGCCAAGCCCGATCATCCCGGCCGCAAACATGTCGTCAGCCTTCTCGATTCT
TTCGAGCACAAGGGCCCGAATGGCACCCACGTCTGCATGGTGTTTGAAGTTTTGGGCGAGAACCTGCTCGGTCTT
ATCAAGCGATGGAATCACCGCGGCATTCCCATGCCCCTCGTGAAGCAAATCACCAAACAGGTTCTTCTCGGCCTC
GACTACCTCCATCGCGAGTGCGGCATCATCCACACCGATCTCAAGCCCGAGAACGTTCTCATTGAGATCGGCGAC
GTCGAGCAGATCGTCAAGAAGGTTGTCAAGAACGACGTTGGCGATAAGGAGAACAACCGAAATGGCCGTCGGCGG
AGGAGGACCCTCATTACCGGCAGCCAGCCCCTACCCTCGCCTCTGAACTCGACCTTTAACCAATCCAACCTGTTT
CCTTCGCCGGGCTCTCAGCCCAGTCTCGCCGGCGTCCTTGGTCAAGGTAAAATACTGCTCACCACCATCATCCTT
CGCCGCGGTACTGACAGGGCCACAGCCTCGGGTGGTTCTAAGGAATCTCCGCAAAAGTCACCCGACGAGTCGCAG
AAGCAGAGGGAGAAGTCGGCGTGAGTCCCCATACCCCGGCAGAAAAGGCCACGGCGCCATGGCTGACCTGTTTCG
TCTTTCTGCAGCGATGTCTTGAGCCGTGAGGTTTCCGGCATTTCGCTCGACAAATCTAGCAGCTCATCCGTCTCG
ACCGGCGAAAAGCGCAAGGCCGAAGATTCGCACTCCTTTGATATTATCAGTGTCAAGATTGCCGATCTCGGCAAC
GCCTGCTGGGTCAATCATCACTTCACCAACGACATCCAGACCAGGCAATATCGCTCGCCCGAGGTTATCCTCGGC
TCCAAGTGGGGTGCCAGCACCGACGTCTGGAGCATGGCAGCAATGGTTTGTCTTCGAATCATCGACTGGATGAGC
TCCACGCTGACATGTCTCGGGCGATAGGTGTTCGAGTTGATTACGGGCGATTACCTCTTCGACCCGCAGTCGGGC
ACGAAATACGGTAAAGACGACGATCACATCGCCCAGATTATCGAACTGGTTGGCTCGTTTCCGCGATCGCTGTGC
TTGAGCGGCAAGTGGAGCCAGGAGATTTTCAACCGGAAGGGCGAGCTGCGTAACATACACCGGTTGCGACACTGG
GCGCTGCCCGACGTGCTCCGAGAAAAATACCACTTCAAGGAGGACGAGGCGAAGCGCATCTCAAACTTCTTGTCG
CCGATGCTAGAGCTCGTACCTGAAAAGAGGGCCAACGCGGGGGGCATGGCGGGTCACGGCTGGCTAGAAGACACG
CCAGGTATGAAGGGGCTCAGGATCGATGGCCTCGAGGTTGGAGGCCGCGGAGAAGGCATCGACGGCTGGGCGACG
GAAGTGAGGAAACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail