Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1168
Gene name
LocationContig_1446:684..2077
Strand+
Gene length (bp)1393
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18055 RPN6_N 26S proteasome regulatory subunit RPN6 N-terminal domain 1.4E-39 12 129
PF01399 PCI PCI domain 5.1E-20 286 387
PF18503 RPN6_C_helix 26S proteasome subunit RPN6 C-terminal helix domain 6.9E-10 393 419

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7S2|RPN6_SCHPO Probable 26S proteasome regulatory subunit rpn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn6 PE=3 SV=1 4 422 2.0E-151
sp|Q8BG32|PSD11_MOUSE 26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus GN=Psmd11 PE=1 SV=3 1 421 6.0E-142
sp|F1LMZ8|PSD11_RAT 26S proteasome non-ATPase regulatory subunit 11 OS=Rattus norvegicus GN=Psmd11 PE=1 SV=2 1 421 8.0E-142
sp|O00231|PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens GN=PSMD11 PE=1 SV=3 1 421 8.0E-142
sp|Q2KI42|PSD11_BOVIN 26S proteasome non-ATPase regulatory subunit 11 OS=Bos taurus GN=PSMD11 PE=2 SV=3 1 421 8.0E-142
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7S2|RPN6_SCHPO Probable 26S proteasome regulatory subunit rpn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn6 PE=3 SV=1 4 422 2.0E-151
sp|Q8BG32|PSD11_MOUSE 26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus GN=Psmd11 PE=1 SV=3 1 421 6.0E-142
sp|F1LMZ8|PSD11_RAT 26S proteasome non-ATPase regulatory subunit 11 OS=Rattus norvegicus GN=Psmd11 PE=1 SV=2 1 421 8.0E-142
sp|O00231|PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens GN=PSMD11 PE=1 SV=3 1 421 8.0E-142
sp|Q2KI42|PSD11_BOVIN 26S proteasome non-ATPase regulatory subunit 11 OS=Bos taurus GN=PSMD11 PE=2 SV=3 1 421 8.0E-142
sp|F6XBL2|PSD11_XENTR 26S proteasome non-ATPase regulatory subunit 11 OS=Xenopus tropicalis GN=psmd11 PE=3 SV=2 1 421 8.0E-141
sp|F1QGH9|PS11B_DANRE 26S proteasome non-ATPase regulatory subunit 11B OS=Danio rerio GN=psmd11b PE=2 SV=1 1 421 5.0E-138
sp|Q7KLV9|PSD11_DROME 26S proteasome non-ATPase regulatory subunit 11 OS=Drosophila melanogaster GN=Rpn6 PE=1 SV=1 47 415 5.0E-137
sp|F6P3G4|PS11A_DANRE 26S proteasome non-ATPase regulatory subunit 11A OS=Danio rerio GN=psmd11a PE=2 SV=1 3 421 5.0E-137
sp|Q9LP45|PSD11_ARATH 26S proteasome non-ATPase regulatory subunit 11 homolog OS=Arabidopsis thaliana GN=RPN6 PE=1 SV=1 37 422 3.0E-115
sp|Q12377|RPN6_YEAST 26S proteasome regulatory subunit RPN6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN6 PE=1 SV=3 6 422 4.0E-115
sp|Q20938|PS11A_CAEEL Probable 26S proteasome regulatory subunit rpn-6.1 OS=Caenorhabditis elegans GN=rpn-6.1 PE=2 SV=2 26 421 8.0E-113
sp|Q54UB5|PSD11_DICDI 26S proteasome non-ATPase regulatory subunit 11 OS=Dictyostelium discoideum GN=psmD11 PE=2 SV=1 47 420 9.0E-111
sp|A8X379|PS11B_CAEBR Probable 26S proteasome regulatory subunit rpn-6.2 OS=Caenorhabditis briggsae GN=rpn-6.2 PE=3 SV=1 18 416 4.0E-77
sp|P34481|PS11B_CAEEL Probable 26S proteasome regulatory subunit rpn-6.2 OS=Caenorhabditis elegans GN=rpn-6.2 PE=3 SV=3 20 416 1.0E-74
sp|Q6IR75|CSN2_XENLA COP9 signalosome complex subunit 2 (Fragment) OS=Xenopus laevis GN=csn2 PE=2 SV=1 110 419 2.0E-19
sp|P61203|CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus GN=Cops2 PE=1 SV=1 131 419 2.0E-19
sp|P61202|CSN2_MOUSE COP9 signalosome complex subunit 2 OS=Mus musculus GN=Cops2 PE=1 SV=1 131 419 2.0E-19
sp|P61201|CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens GN=COPS2 PE=1 SV=1 131 419 2.0E-19
sp|Q6IQT4|CSN2_DANRE COP9 signalosome complex subunit 2 OS=Danio rerio GN=cops2 PE=2 SV=1 165 419 2.0E-19
sp|Q94899|CSN2_DROME COP9 signalosome complex subunit 2 OS=Drosophila melanogaster GN=alien PE=1 SV=2 165 380 8.0E-16
sp|Q54HL6|CSN2_DICDI COP9 signalosome complex subunit 2 OS=Dictyostelium discoideum GN=csn2 PE=1 SV=1 165 380 2.0E-12
sp|Q5B3U7|CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnB PE=1 SV=2 131 387 2.0E-10
sp|O01422|CSN2_CAEEL COP9 signalosome complex subunit 2 OS=Caenorhabditis elegans GN=csn-2 PE=1 SV=2 165 385 2.0E-10
sp|Q8W207|CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana GN=CSN2 PE=1 SV=1 165 380 6.0E-10
sp|Q9HFR0|CSN2_SCHPO COP9 signalosome complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn2 PE=1 SV=1 215 379 6.0E-10
sp|Q7SI58|CSN2_NEUCR COP9 signalosome complex subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-2 PE=1 SV=1 167 415 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1168
MAASDSSRLQEAQKLAKTDPRKAEAIFRDMTAKAPQATSDSATREYETALISLGELYRDERKTQELVDLVRESRS
VFSSFAKAKSSKLVRQLLDLFKDMPNSTDTEAYITKDCIAWATAERRAFQRQDLQVRLVALYMTKQSYYEALTLI
NGLLRELKRLDDKLRLVEVQLLESRVYHALGNIAKARAALTTARTSAASVYTPPLLQANLDMQSGMLHAEDKDFN
TAYSYFIEALDGYNSLDSGGKAQAALQYMLLCKIMLNLVDDVNQLMASKQAVKYAGKNLEAMKAIARAHSNRSLD
EYERALSTYRYELGADAFIRNHLRRLYDAMLEQNLIKVIEPFSRVEMDHIARMVGLDTQQVERKLSQMILDKVII
GVLDQGAGCLIIFDETQRDESYDAALATIDKLSNVVDVLYTNQASLLE*
Coding >Ophun1|1168
ATGGCAGCCAGCGACTCCTCACGGCTGCAAGAAGCCCAGAAGCTGGCCAAGACGGACCCCCGCAAGGCAGAGGCC
ATCTTCCGCGACATGACGGCCAAGGCACCCCAGGCCACGTCTGATTCCGCGACGCGCGAGTACGAGACGGCGCTG
ATCAGCCTGGGCGAGCTGTACCGAGACGAGAGGAAGACGCAGGAGTTGGTGGACTTGGTGCGTGAGAGCCGCTCC
GTCTTCTCTTCCTTTGCCAAGGCCAAGTCATCCAAGCTGGTCCGGCAACTCCTCGACCTCTTCAAAGACATGCCC
AACAGCACCGACACAGAAGCCTACATCACAAAGGACTGCATCGCATGGGCGACAGCAGAGCGGAGGGCCTTCCAG
CGTCAGGACCTCCAAGTCCGACTGGTAGCCCTCTACATGACCAAGCAATCCTACTACGAAGCCCTAACGCTCATC
AACGGCCTCCTCCGCGAACTCAAACGCCTCGACGACAAACTCCGCCTCGTCGAAGTCCAACTCCTCGAATCGCGC
GTCTACCACGCCCTCGGCAACATTGCCAAAGCCCGCGCCGCCCTCACAACAGCCCGCACCAGCGCCGCAAGCGTC
TACACCCCTCCCCTCCTGCAGGCCAACCTCGACATGCAGAGCGGCATGCTGCACGCCGAGGACAAGGACTTCAAC
ACGGCCTACTCGTACTTCATCGAGGCCCTCGACGGCTACAACAGCCTCGACTCGGGCGGAAAGGCACAGGCAGCG
CTGCAGTACATGCTCCTCTGCAAAATCATGCTCAACCTCGTCGACGACGTAAACCAGCTCATGGCCTCGAAACAA
GCCGTCAAATACGCCGGCAAAAACCTCGAAGCCATGAAGGCCATAGCCCGCGCCCACTCCAACCGCTCGCTGGAC
GAGTACGAGCGCGCCCTCTCAACCTACCGCTACGAACTCGGCGCCGACGCCTTCATCCGCAACCACCTCCGCCGC
CTCTACGACGCCATGCTGGAGCAGAACCTCATCAAGGTCATTGAGCCCTTTTCCCGCGTCGAGATGGATCATATC
GCTCGCATGGTTGGCCTCGATACGCAGCAGGTTGAGCGGAAGCTCTCGCAGATGATTCTCGACAAGGTTATTATC
GGCGTGCTGGATCAGGGTGCTGGGTGTCTCATCATCTTTGATGAGACGCAGAGGGATGAGTCGTATGATGCTGCG
TTGGCGACGATTGATAAGCTTAGCAATGTCGTTGACGTCTTGTATACTAACCAGGCCTCGTTGCTAGAGTAA
Transcript >Ophun1|1168
ATGGCAGCCAGCGACTCCTCACGGCTGCAAGAAGCCCAGAAGCTGGCCAAGACGGACCCCCGCAAGGCAGAGGCC
ATCTTCCGCGACATGACGGCCAAGGCACCCCAGGCCACGTCTGATTCCGCGACGCGCGAGTACGAGACGGCGCTG
ATCAGCCTGGGCGAGCTGTACCGAGACGAGAGGAAGACGCAGGAGTTGGTGGACTTGGTGCGTGAGAGCCGCTCC
GTCTTCTCTTCCTTTGCCAAGGCCAAGTCATCCAAGCTGGTCCGGCAACTCCTCGACCTCTTCAAAGACATGCCC
AACAGCACCGACACAGAAGCCTACATCACAAAGGACTGCATCGCATGGGCGACAGCAGAGCGGAGGGCCTTCCAG
CGTCAGGACCTCCAAGTCCGACTGGTAGCCCTCTACATGACCAAGCAATCCTACTACGAAGCCCTAACGCTCATC
AACGGCCTCCTCCGCGAACTCAAACGCCTCGACGACAAACTCCGCCTCGTCGAAGTCCAACTCCTCGAATCGCGC
GTCTACCACGCCCTCGGCAACATTGCCAAAGCCCGCGCCGCCCTCACAACAGCCCGCACCAGCGCCGCAAGCGTC
TACACCCCTCCCCTCCTGCAGGCCAACCTCGACATGCAGAGCGGCATGCTGCACGCCGAGGACAAGGACTTCAAC
ACGGCCTACTCGTACTTCATCGAGGCCCTCGACGGCTACAACAGCCTCGACTCGGGCGGAAAGGCACAGGCAGCG
CTGCAGTACATGCTCCTCTGCAAAATCATGCTCAACCTCGTCGACGACGTAAACCAGCTCATGGCCTCGAAACAA
GCCGTCAAATACGCCGGCAAAAACCTCGAAGCCATGAAGGCCATAGCCCGCGCCCACTCCAACCGCTCGCTGGAC
GAGTACGAGCGCGCCCTCTCAACCTACCGCTACGAACTCGGCGCCGACGCCTTCATCCGCAACCACCTCCGCCGC
CTCTACGACGCCATGCTGGAGCAGAACCTCATCAAGGTCATTGAGCCCTTTTCCCGCGTCGAGATGGATCATATC
GCTCGCATGGTTGGCCTCGATACGCAGCAGGTTGAGCGGAAGCTCTCGCAGATGATTCTCGACAAGGTTATTATC
GGCGTGCTGGATCAGGGTGCTGGGTGTCTCATCATCTTTGATGAGACGCAGAGGGATGAGTCGTATGATGCTGCG
TTGGCGACGATTGATAAGCTTAGCAATGTCGTTGACGTCTTGTATACTAACCAGGCCTCGTTGCTAGAGTAA
Gene >Ophun1|1168
ATGGCAGCCAGCGACTCCTCACGGCTGCAAGAAGCCCAGAAGCTGGCCAAGACGGACCCCCGCAAGGCAGAGGCC
ATCTTCCGCGACATGACGGCCAAGGCACCCCAGGCCACGTCTGATTCCGCGACGCGCGAGTACGAGACGGCGCTG
ATCAGCCTGGGCGAGCTGTACCGAGACGAGAGGTTTGGGATTTCCCAGCTGGATTGCTTTGGTTTCCCCTGCTGA
TGGTCTTGTCGGGTATAGGAAGACGCAGGAGTTGGTGGACTTGGTGCGTGAGAGCCGCTCCGTCTTCTCTTCCTT
TGCCAAGGCCAAGTCATCCAAGCTGGGTCAGTTCCCCCCATCCAGATCTCACCTCGTCTCTCCCCGTCTTAACAA
GCCACACTCAGTCCGGCAACTCCTCGACCTCTTCAAAGACATGCCCAACAGCACCGACACAGAAGCCTACATCAC
AAAGGACTGCATCGCATGGGCGACAGCAGAGCGGAGGGCCTTCCAGCGTCAGGACCTCCAAGTCCGACTGGTAGC
CCTCTACATGACCAAGCAATCCTACTACGAAGCCCTAACGCTCATCAACGGCCTCCTCCGCGAACTCAAACGCCT
CGACGACAAACTCCGCCTCGTCGAAGTCCAACTCCTCGAATCGCGCGTCTACCACGCCCTCGGCAACATTGCCAA
AGCCCGCGCCGCCCTCACAACAGCCCGCACCAGCGCCGCAAGCGTCTACACCCCTCCCCTCCTGCAGGCCAACCT
CGACATGCAGAGCGGCATGCTGCACGCCGAGGACAAGGACTTCAACACGGCCTACTCGTACTTCATCGAGGCCCT
CGACGGCTACAACAGCCTCGACTCGGGCGGAAAGGCACAGGCAGCGCTGCAGTACATGCTCCTCTGCAAAATCAT
GCTCAACCTCGTCGACGACGTAAACCAGCTCATGGCCTCGAAACAAGCCGTCAAATACGCCGGCAAAAACCTCGA
AGCCATGAAGGCCATAGCCCGCGCCCACTCCAACCGCTCGCTGGACGAGTACGAGCGCGCCCTCTCAACCTACCG
CTACGAACTCGGCGCCGACGCCTTCATCCGCAACCACCTCCGCCGCCTCTACGACGCCATGCTGGAGCAGAACCT
CATCAAGGTCATTGAGCCCTTTTCCCGCGTCGAGATGGATCATATCGCTCGCATGGTTGGCCTCGATACGCAGCA
GGTTGAGCGGAAGCTCTCGCAGATGATTCTCGACAAGGTTATTATCGGCGTGCTGGATCAGGGTGCTGGGTGTCT
CATCATCTTTGATGAGACGCAGAGGGATGAGTCGTATGATGCTGCGTTGGCGACGATTGATAAGCTTAGCAATGT
CGTTGACGTCTTGTATACTAACCAGGCCTCGTTGCTAGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail