Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1150
Gene name
LocationContig_1434:691..2027
Strand-
Gene length (bp)1336
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00551 Formyl_trans_N Formyl transferase 3.3E-18 106 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32785|FMT_YEAST Methionyl-tRNA formyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMT1 PE=1 SV=2 15 252 1.0E-26
sp|Q2GFU1|FMT_EHRCR Methionyl-tRNA formyltransferase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=fmt PE=3 SV=1 29 219 1.0E-20
sp|Q96DP5|FMT_HUMAN Methionyl-tRNA formyltransferase, mitochondrial OS=Homo sapiens GN=MTFMT PE=1 SV=2 28 269 2.0E-20
sp|A6TEU1|FMT_KLEP7 Methionyl-tRNA formyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fmt PE=3 SV=1 25 267 8.0E-20
sp|Q3IZH6|FMT_RHOS4 Methionyl-tRNA formyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=fmt PE=3 SV=1 29 271 9.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32785|FMT_YEAST Methionyl-tRNA formyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMT1 PE=1 SV=2 15 252 1.0E-26
sp|Q2GFU1|FMT_EHRCR Methionyl-tRNA formyltransferase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=fmt PE=3 SV=1 29 219 1.0E-20
sp|Q96DP5|FMT_HUMAN Methionyl-tRNA formyltransferase, mitochondrial OS=Homo sapiens GN=MTFMT PE=1 SV=2 28 269 2.0E-20
sp|A6TEU1|FMT_KLEP7 Methionyl-tRNA formyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fmt PE=3 SV=1 25 267 8.0E-20
sp|Q3IZH6|FMT_RHOS4 Methionyl-tRNA formyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=fmt PE=3 SV=1 29 271 9.0E-20
sp|Q31VY9|FMT_SHIBS Methionyl-tRNA formyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=fmt PE=3 SV=1 25 267 2.0E-19
sp|Q9D799|FMT_MOUSE Methionyl-tRNA formyltransferase, mitochondrial OS=Mus musculus GN=Mtfmt PE=2 SV=3 28 265 2.0E-19
sp|B9KML7|FMT_RHOSK Methionyl-tRNA formyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=fmt PE=3 SV=1 29 271 2.0E-19
sp|A3PMS1|FMT_RHOS1 Methionyl-tRNA formyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=fmt PE=3 SV=1 29 292 3.0E-19
sp|B6I201|FMT_ECOSE Methionyl-tRNA formyltransferase OS=Escherichia coli (strain SE11) GN=fmt PE=3 SV=1 25 267 4.0E-19
sp|B5FJI3|FMT_SALDC Methionyl-tRNA formyltransferase OS=Salmonella dublin (strain CT_02021853) GN=fmt PE=3 SV=1 25 267 4.0E-19
sp|Q5LNI8|FMT_RUEPO Methionyl-tRNA formyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=fmt PE=3 SV=1 29 273 6.0E-19
sp|B7NDQ9|FMT_ECOLU Methionyl-tRNA formyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fmt PE=3 SV=1 25 267 6.0E-19
sp|Q8ZLM6|FMT_SALTY Methionyl-tRNA formyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fmt PE=3 SV=3 25 267 6.0E-19
sp|B4TXB1|FMT_SALSV Methionyl-tRNA formyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=fmt PE=3 SV=1 25 267 6.0E-19
sp|B5BGV4|FMT_SALPK Methionyl-tRNA formyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=fmt PE=3 SV=1 25 267 6.0E-19
sp|C0PZV0|FMT_SALPC Methionyl-tRNA formyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=fmt PE=3 SV=1 25 267 6.0E-19
sp|A9N8B2|FMT_SALPB Methionyl-tRNA formyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fmt PE=3 SV=1 25 267 6.0E-19
sp|Q5PIT7|FMT_SALPA Methionyl-tRNA formyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fmt PE=3 SV=3 25 267 6.0E-19
sp|B4SUQ9|FMT_SALNS Methionyl-tRNA formyltransferase OS=Salmonella newport (strain SL254) GN=fmt PE=3 SV=1 25 267 6.0E-19
sp|B4TJX8|FMT_SALHS Methionyl-tRNA formyltransferase OS=Salmonella heidelberg (strain SL476) GN=fmt PE=3 SV=1 25 267 6.0E-19
sp|Q57J63|FMT_SALCH Methionyl-tRNA formyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=fmt PE=3 SV=3 25 267 6.0E-19
sp|B5F7R4|FMT_SALA4 Methionyl-tRNA formyltransferase OS=Salmonella agona (strain SL483) GN=fmt PE=3 SV=1 25 267 6.0E-19
sp|B1LGP4|FMT_ECOSM Methionyl-tRNA formyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fmt PE=3 SV=1 25 267 7.0E-19
sp|A8LLC0|FMT_DINSH Methionyl-tRNA formyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=fmt PE=3 SV=1 29 273 8.0E-19
sp|Q8Z1X0|FMT_SALTI Methionyl-tRNA formyltransferase OS=Salmonella typhi GN=fmt PE=3 SV=3 25 267 8.0E-19
sp|Q5M3I7|FMT_STRT2 Methionyl-tRNA formyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=fmt PE=3 SV=1 30 252 8.0E-19
sp|Q5LYX4|FMT_STRT1 Methionyl-tRNA formyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=fmt PE=3 SV=1 30 252 8.0E-19
sp|Q8FD13|FMT_ECOL6 Methionyl-tRNA formyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fmt PE=3 SV=3 25 267 9.0E-19
sp|Q1GDF7|FMT_RUEST Methionyl-tRNA formyltransferase OS=Ruegeria sp. (strain TM1040) GN=fmt PE=3 SV=1 29 273 1.0E-18
sp|Q5I0C5|FMT_RAT Methionyl-tRNA formyltransferase, mitochondrial OS=Rattus norvegicus GN=Mtfmt PE=2 SV=1 28 265 1.0E-18
sp|Q32B62|FMT_SHIDS Methionyl-tRNA formyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B7NLK7|FMT_ECO7I Methionyl-tRNA formyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|Q3YWX2|FMT_SHISS Methionyl-tRNA formyltransferase OS=Shigella sonnei (strain Ss046) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|P23882|FMT_ECOLI Methionyl-tRNA formyltransferase OS=Escherichia coli (strain K12) GN=fmt PE=1 SV=4 25 267 1.0E-18
sp|B1IQ12|FMT_ECOLC Methionyl-tRNA formyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|A8A592|FMT_ECOHS Methionyl-tRNA formyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B1X6E0|FMT_ECODH Methionyl-tRNA formyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|C4ZUE2|FMT_ECOBW Methionyl-tRNA formyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B7LHY8|FMT_ECO55 Methionyl-tRNA formyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B7UK11|FMT_ECO27 Methionyl-tRNA formyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|Q1R645|FMT_ECOUT Methionyl-tRNA formyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|A1AGH9|FMT_ECOK1 Methionyl-tRNA formyltransferase OS=Escherichia coli O1:K1 / APEC GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B7N172|FMT_ECO81 Methionyl-tRNA formyltransferase OS=Escherichia coli O81 (strain ED1a) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B7MCQ3|FMT_ECO45 Methionyl-tRNA formyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B2U2Q5|FMT_SHIB3 Methionyl-tRNA formyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B5YT07|FMT_ECO5E Methionyl-tRNA formyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|Q8X8F1|FMT_ECO57 Methionyl-tRNA formyltransferase OS=Escherichia coli O157:H7 GN=fmt PE=3 SV=3 25 267 1.0E-18
sp|B7M0Z3|FMT_ECO8A Methionyl-tRNA formyltransferase OS=Escherichia coli O8 (strain IAI1) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|A7ZSH6|FMT_ECO24 Methionyl-tRNA formyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B5RH48|FMT_SALG2 Methionyl-tRNA formyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B5R1E4|FMT_SALEP Methionyl-tRNA formyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=fmt PE=3 SV=1 25 267 1.0E-18
sp|B7LRQ4|FMT_ESCF3 Methionyl-tRNA formyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fmt PE=3 SV=1 25 267 2.0E-18
sp|A3QJF5|FMT_SHELP Methionyl-tRNA formyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fmt PE=3 SV=1 28 267 2.0E-18
sp|B5XNC3|FMT_KLEP3 Methionyl-tRNA formyltransferase OS=Klebsiella pneumoniae (strain 342) GN=fmt PE=3 SV=1 25 267 2.0E-18
sp|A4WNU8|FMT_RHOS5 Methionyl-tRNA formyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=fmt PE=3 SV=1 29 292 2.0E-18
sp|Q83PZ0|FMT_SHIFL Methionyl-tRNA formyltransferase OS=Shigella flexneri GN=fmt PE=3 SV=1 25 267 2.0E-18
sp|Q0T015|FMT_SHIF8 Methionyl-tRNA formyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=fmt PE=3 SV=1 25 267 2.0E-18
sp|Q0TCH4|FMT_ECOL5 Methionyl-tRNA formyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fmt PE=3 SV=1 25 267 3.0E-18
sp|B8F7U6|FMT_HAEPS Methionyl-tRNA formyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=fmt PE=3 SV=1 29 317 3.0E-18
sp|Q9KVU4|FMT_VIBCH Methionyl-tRNA formyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fmt PE=1 SV=1 25 267 4.0E-18
sp|A5F4B4|FMT_VIBC3 Methionyl-tRNA formyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fmt PE=3 SV=1 25 267 4.0E-18
sp|Q15ZY3|FMT_PSEA6 Methionyl-tRNA formyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=fmt PE=3 SV=1 29 292 4.0E-18
sp|Q0AJ02|FMT_NITEC Methionyl-tRNA formyltransferase OS=Nitrosomonas eutropha (strain C91) GN=fmt PE=3 SV=1 29 283 6.0E-18
sp|A1AZR0|FMT_PARDP Methionyl-tRNA formyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=fmt PE=3 SV=1 29 273 8.0E-18
sp|B1KCW3|FMT_SHEWM Methionyl-tRNA formyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fmt PE=3 SV=1 28 267 8.0E-18
sp|A5ESQ6|FMT_BRASB Methionyl-tRNA formyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=fmt PE=3 SV=1 28 286 1.0E-17
sp|O77480|FMT_BOVIN Methionyl-tRNA formyltransferase, mitochondrial OS=Bos taurus GN=MTFMT PE=1 SV=2 28 269 1.0E-17
sp|Q9UTG6|FMT_SCHPO Putative methionyl-tRNA formyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmt1 PE=3 SV=1 28 279 2.0E-17
sp|A5FVK3|FMT_ACICJ Methionyl-tRNA formyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=fmt PE=3 SV=1 29 266 2.0E-17
sp|A6WHB0|FMT_SHEB8 Methionyl-tRNA formyltransferase OS=Shewanella baltica (strain OS185) GN=fmt PE=3 SV=1 28 267 3.0E-17
sp|Q6LLJ2|FMT_PHOPR Methionyl-tRNA formyltransferase OS=Photobacterium profundum GN=fmt PE=3 SV=1 25 267 3.0E-17
sp|Q92SH5|FMT_RHIME Methionyl-tRNA formyltransferase OS=Rhizobium meliloti (strain 1021) GN=fmt PE=3 SV=1 28 264 3.0E-17
sp|B0UWZ4|FMT_HISS2 Methionyl-tRNA formyltransferase OS=Histophilus somni (strain 2336) GN=fmt PE=3 SV=1 28 299 4.0E-17
sp|A4WF96|FMT_ENT38 Methionyl-tRNA formyltransferase OS=Enterobacter sp. (strain 638) GN=fmt PE=3 SV=1 25 267 5.0E-17
sp|C3LPB8|FMT_VIBCM Methionyl-tRNA formyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=fmt PE=3 SV=1 25 267 7.0E-17
sp|Q603G2|FMT_METCA Methionyl-tRNA formyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=fmt PE=3 SV=1 29 267 7.0E-17
sp|Q5HBX2|FMT_EHRRW Methionyl-tRNA formyltransferase OS=Ehrlichia ruminantium (strain Welgevonden) GN=fmt PE=3 SV=1 29 213 8.0E-17
sp|Q0I182|FMT_HAES1 Methionyl-tRNA formyltransferase OS=Haemophilus somnus (strain 129Pt) GN=fmt PE=3 SV=1 28 299 8.0E-17
sp|Q5FFG4|FMT_EHRRG Methionyl-tRNA formyltransferase OS=Ehrlichia ruminantium (strain Gardel) GN=fmt PE=3 SV=1 29 213 9.0E-17
sp|Q725Q9|FMT_DESVH Methionyl-tRNA formyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=fmt PE=3 SV=1 26 264 1.0E-16
sp|Q83AA8|FMT_COXBU Methionyl-tRNA formyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fmt PE=1 SV=1 29 283 1.0E-16
sp|A9N9H5|FMT_COXBR Methionyl-tRNA formyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=fmt PE=3 SV=1 29 283 1.0E-16
sp|A9KH14|FMT_COXBN Methionyl-tRNA formyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=fmt PE=3 SV=1 29 283 1.0E-16
sp|B6J3C2|FMT_COXB2 Methionyl-tRNA formyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=fmt PE=3 SV=1 29 283 1.0E-16
sp|C6DFR6|FMT_PECCP Methionyl-tRNA formyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fmt PE=3 SV=1 25 267 1.0E-16
sp|A1V9B4|FMT_DESVV Methionyl-tRNA formyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=fmt PE=3 SV=1 26 264 1.0E-16
sp|A4XL81|FMT_CALS8 Methionyl-tRNA formyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=fmt PE=3 SV=1 92 271 1.0E-16
sp|Q08A29|FMT_SHEFN Methionyl-tRNA formyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=fmt PE=3 SV=1 28 267 1.0E-16
sp|A8FP74|FMT_SHESH Methionyl-tRNA formyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=fmt PE=3 SV=1 28 277 2.0E-16
sp|B2A2K2|FMT_NATTJ Methionyl-tRNA formyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=fmt PE=3 SV=1 29 261 2.0E-16
sp|A4ST58|FMT_AERS4 Methionyl-tRNA formyltransferase OS=Aeromonas salmonicida (strain A449) GN=fmt PE=3 SV=1 27 267 2.0E-16
sp|Q9K9Y6|FMT_BACHD Methionyl-tRNA formyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=fmt PE=3 SV=1 109 252 2.0E-16
sp|Q47K50|FMT_DECAR Methionyl-tRNA formyltransferase OS=Dechloromonas aromatica (strain RCB) GN=fmt PE=3 SV=1 29 266 2.0E-16
sp|Q6F6P9|FMT_ACIAD Methionyl-tRNA formyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fmt PE=3 SV=1 29 267 2.0E-16
sp|A3CYK4|FMT_SHEB5 Methionyl-tRNA formyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fmt PE=3 SV=1 28 267 2.0E-16
sp|C0QUK8|FMT_PERMH Methionyl-tRNA formyltransferase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=fmt PE=3 SV=1 29 286 2.0E-16
sp|A7HPQ2|FMT_PARL1 Methionyl-tRNA formyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=fmt PE=3 SV=1 29 286 2.0E-16
sp|C0RMH3|FMT_BRUMB Methionyl-tRNA formyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=fmt PE=3 SV=1 29 264 2.0E-16
sp|Q3IDI3|FMT_PSEHT Methionyl-tRNA formyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fmt PE=3 SV=1 25 288 2.0E-16
sp|Q576T0|FMT_BRUAB Methionyl-tRNA formyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=fmt PE=3 SV=1 29 264 3.0E-16
sp|Q2YJQ3|FMT_BRUA2 Methionyl-tRNA formyltransferase OS=Brucella abortus (strain 2308) GN=fmt PE=3 SV=1 29 264 3.0E-16
sp|B2SC20|FMT_BRUA1 Methionyl-tRNA formyltransferase OS=Brucella abortus (strain S19) GN=fmt PE=3 SV=1 29 264 3.0E-16
sp|B8E3S3|FMT_SHEB2 Methionyl-tRNA formyltransferase OS=Shewanella baltica (strain OS223) GN=fmt PE=3 SV=1 28 267 3.0E-16
sp|P64133|FMT_BRUSU Methionyl-tRNA formyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=fmt PE=3 SV=1 29 264 3.0E-16
sp|P64132|FMT_BRUME Methionyl-tRNA formyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fmt PE=3 SV=1 29 264 3.0E-16
sp|A9MCV9|FMT_BRUC2 Methionyl-tRNA formyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=fmt PE=3 SV=1 29 264 3.0E-16
sp|A9WW44|FMT_BRUSI Methionyl-tRNA formyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=fmt PE=3 SV=1 29 264 3.0E-16
sp|Q5E1Q7|FMT_VIBF1 Methionyl-tRNA formyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fmt PE=3 SV=1 25 250 3.0E-16
sp|A5VVU0|FMT_BRUO2 Methionyl-tRNA formyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=fmt PE=3 SV=1 29 264 3.0E-16
sp|B4F1L6|FMT_PROMH Methionyl-tRNA formyltransferase OS=Proteus mirabilis (strain HI4320) GN=fmt PE=3 SV=1 25 267 4.0E-16
sp|A9KUA1|FMT_SHEB9 Methionyl-tRNA formyltransferase OS=Shewanella baltica (strain OS195) GN=fmt PE=3 SV=1 28 267 4.0E-16
sp|B6JJP7|FMT_OLICO Methionyl-tRNA formyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=fmt PE=3 SV=1 28 286 4.0E-16
sp|A5D1B9|FMT_PELTS Methionyl-tRNA formyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=fmt PE=3 SV=1 29 264 4.0E-16
sp|C4K6Y1|FMT_HAMD5 Methionyl-tRNA formyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=fmt PE=3 SV=1 25 250 4.0E-16
sp|Q16AL2|FMT_ROSDO Methionyl-tRNA formyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=fmt PE=3 SV=1 29 271 5.0E-16
sp|Q6AQ97|FMT_DESPS Methionyl-tRNA formyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=fmt PE=3 SV=1 22 255 6.0E-16
sp|Q03RS3|FMT_LACBA Methionyl-tRNA formyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=fmt PE=3 SV=1 31 203 6.0E-16
sp|A3N2N5|FMT_ACTP2 Methionyl-tRNA formyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=fmt PE=3 SV=1 29 267 6.0E-16
sp|A6WYK8|FMT_OCHA4 Methionyl-tRNA formyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=fmt PE=3 SV=1 29 286 6.0E-16
sp|Q3YSQ0|FMT_EHRCJ Methionyl-tRNA formyltransferase OS=Ehrlichia canis (strain Jake) GN=fmt PE=3 SV=1 29 211 7.0E-16
sp|B5FCW7|FMT_VIBFM Methionyl-tRNA formyltransferase OS=Vibrio fischeri (strain MJ11) GN=fmt PE=3 SV=1 25 250 8.0E-16
sp|Q8EKQ9|FMT_SHEON Methionyl-tRNA formyltransferase OS=Shewanella oneidensis (strain MR-1) GN=fmt PE=3 SV=1 28 267 8.0E-16
sp|Q0I0S3|FMT_SHESR Methionyl-tRNA formyltransferase OS=Shewanella sp. (strain MR-7) GN=fmt PE=3 SV=1 28 267 8.0E-16
sp|A8GKG6|FMT_SERP5 Methionyl-tRNA formyltransferase OS=Serratia proteamaculans (strain 568) GN=fmt PE=3 SV=1 25 250 9.0E-16
sp|B0BRR3|FMT_ACTPJ Methionyl-tRNA formyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=fmt PE=3 SV=1 29 267 9.0E-16
sp|B3GYS0|FMT_ACTP7 Methionyl-tRNA formyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=fmt PE=3 SV=1 29 267 9.0E-16
sp|P64138|FMT_STRA5 Methionyl-tRNA formyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=fmt PE=3 SV=1 30 264 1.0E-15
sp|P64137|FMT_STRA3 Methionyl-tRNA formyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=fmt PE=3 SV=1 30 264 1.0E-15
sp|Q3K365|FMT_STRA1 Methionyl-tRNA formyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=fmt PE=3 SV=1 30 264 1.0E-15
sp|Q48AS9|FMT_COLP3 Methionyl-tRNA formyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fmt PE=3 SV=1 28 266 1.0E-15
sp|O67890|FMT_AQUAE Methionyl-tRNA formyltransferase OS=Aquifex aeolicus (strain VF5) GN=fmt PE=3 SV=1 30 271 1.0E-15
sp|Q48QI2|FMT_PSE14 Methionyl-tRNA formyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fmt PE=3 SV=1 25 279 1.0E-15
sp|B6J655|FMT_COXB1 Methionyl-tRNA formyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=fmt PE=3 SV=1 29 283 1.0E-15
sp|A5VDM0|FMT_SPHWW Methionyl-tRNA formyltransferase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=fmt PE=3 SV=1 29 267 1.0E-15
sp|Q9ABE9|FMT_CAUCR Methionyl-tRNA formyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fmt PE=3 SV=1 29 356 1.0E-15
sp|B8GYF1|FMT_CAUCN Methionyl-tRNA formyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=fmt PE=3 SV=1 29 356 1.0E-15
sp|B4SKH6|FMT_STRM5 Methionyl-tRNA formyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=fmt PE=3 SV=1 29 266 1.0E-15
sp|Q98D53|FMT_RHILO Methionyl-tRNA formyltransferase OS=Rhizobium loti (strain MAFF303099) GN=fmt PE=3 SV=1 28 273 1.0E-15
sp|A6U5I5|FMT_SINMW Methionyl-tRNA formyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=fmt PE=3 SV=1 28 264 2.0E-15
sp|Q12TA6|FMT_SHEDO Methionyl-tRNA formyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fmt PE=3 SV=1 28 267 2.0E-15
sp|A3CPX4|FMT_STRSV Methionyl-tRNA formyltransferase OS=Streptococcus sanguinis (strain SK36) GN=fmt PE=3 SV=1 29 252 2.0E-15
sp|Q02WP8|FMT_LACLS Methionyl-tRNA formyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=fmt PE=3 SV=1 30 252 2.0E-15
sp|A5UH91|FMT_HAEIG Methionyl-tRNA formyltransferase OS=Haemophilus influenzae (strain PittGG) GN=fmt PE=3 SV=1 29 299 2.0E-15
sp|B7IUM5|FMT_BACC2 Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain G9842) GN=fmt PE=3 SV=1 109 323 2.0E-15
sp|Q8DDE4|FMT_VIBVU Methionyl-tRNA formyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=fmt PE=3 SV=1 25 250 2.0E-15
sp|A6VKJ6|FMT_ACTSZ Methionyl-tRNA formyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=fmt PE=3 SV=1 29 299 2.0E-15
sp|A7GRJ6|FMT_BACCN Methionyl-tRNA formyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=fmt PE=3 SV=1 109 264 2.0E-15
sp|B2FIR3|FMT_STRMK Methionyl-tRNA formyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=fmt PE=3 SV=1 29 266 2.0E-15
sp|Q88B42|FMT_PSESM Methionyl-tRNA formyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fmt PE=3 SV=1 25 279 2.0E-15
sp|B7HDY9|FMT_BACC4 Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain B4264) GN=fmt PE=3 SV=1 109 323 3.0E-15
sp|Q819U1|FMT_BACCR Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=fmt PE=3 SV=1 109 323 3.0E-15
sp|Q820J7|FMT_NITEU Methionyl-tRNA formyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=fmt PE=3 SV=1 29 273 3.0E-15
sp|A2RN27|FMT_LACLM Methionyl-tRNA formyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=fmt PE=3 SV=1 30 252 3.0E-15
sp|A4Y1C6|FMT_SHEPC Methionyl-tRNA formyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fmt PE=3 SV=1 29 341 3.0E-15
sp|B8CHB1|FMT_SHEPW Methionyl-tRNA formyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fmt PE=3 SV=1 28 267 3.0E-15
sp|A1TWN0|FMT_MARHV Methionyl-tRNA formyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=fmt PE=3 SV=1 29 367 3.0E-15
sp|Q0HPA7|FMT_SHESM Methionyl-tRNA formyltransferase OS=Shewanella sp. (strain MR-4) GN=fmt PE=3 SV=1 28 267 3.0E-15
sp|Q7UHZ6|FMT_RHOBA Methionyl-tRNA formyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=fmt PE=3 SV=1 16 274 3.0E-15
sp|B1JJH7|FMT_YERPY Methionyl-tRNA formyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fmt PE=3 SV=1 25 267 4.0E-15
sp|Q664V3|FMT_YERPS Methionyl-tRNA formyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fmt PE=3 SV=1 25 267 4.0E-15
sp|A4TH22|FMT_YERPP Methionyl-tRNA formyltransferase OS=Yersinia pestis (strain Pestoides F) GN=fmt PE=3 SV=1 25 267 4.0E-15
sp|Q1CCX5|FMT_YERPN Methionyl-tRNA formyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fmt PE=3 SV=1 25 267 4.0E-15
sp|A9R926|FMT_YERPG Methionyl-tRNA formyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fmt PE=3 SV=1 25 267 4.0E-15
sp|Q8ZJ80|FMT_YERPE Methionyl-tRNA formyltransferase OS=Yersinia pestis GN=fmt PE=1 SV=1 25 267 4.0E-15
sp|B2K505|FMT_YERPB Methionyl-tRNA formyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fmt PE=3 SV=1 25 267 4.0E-15
sp|Q1C2X8|FMT_YERPA Methionyl-tRNA formyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fmt PE=3 SV=1 25 267 4.0E-15
sp|A7FNK3|FMT_YERP3 Methionyl-tRNA formyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fmt PE=3 SV=1 25 267 4.0E-15
sp|Q7MGK5|FMT_VIBVY Methionyl-tRNA formyltransferase OS=Vibrio vulnificus (strain YJ016) GN=fmt PE=3 SV=1 25 250 4.0E-15
sp|A7MPE8|FMT_CROS8 Methionyl-tRNA formyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fmt PE=3 SV=1 25 267 4.0E-15
sp|Q636G0|FMT_BACCZ Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=fmt PE=3 SV=1 109 264 4.0E-15
sp|C1EP90|FMT_BACC3 Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain 03BB102) GN=fmt PE=3 SV=1 109 264 4.0E-15
sp|B7JJV3|FMT_BACC0 Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain AH820) GN=fmt PE=3 SV=1 109 264 4.0E-15
sp|Q81WH2|FMT_BACAN Methionyl-tRNA formyltransferase OS=Bacillus anthracis GN=fmt PE=1 SV=1 109 264 4.0E-15
sp|A0RHN9|FMT_BACAH Methionyl-tRNA formyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=fmt PE=3 SV=1 109 264 4.0E-15
sp|C3L761|FMT_BACAC Methionyl-tRNA formyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=fmt PE=3 SV=1 109 264 4.0E-15
sp|C3P637|FMT_BACAA Methionyl-tRNA formyltransferase OS=Bacillus anthracis (strain A0248) GN=fmt PE=3 SV=1 109 264 4.0E-15
sp|Q6G1G8|FMT_BARQU Methionyl-tRNA formyltransferase OS=Bartonella quintana (strain Toulouse) GN=fmt PE=3 SV=1 29 273 4.0E-15
sp|Q2JTY2|FMT_SYNJA Methionyl-tRNA formyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=fmt PE=3 SV=1 29 266 4.0E-15
sp|Q6HEU9|FMT_BACHK Methionyl-tRNA formyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=fmt PE=3 SV=1 109 264 4.0E-15
sp|B9IVF5|FMT_BACCQ Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain Q1) GN=fmt PE=3 SV=1 109 264 4.0E-15
sp|B7HLJ9|FMT_BACC7 Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain AH187) GN=fmt PE=3 SV=1 109 264 4.0E-15
sp|Q87KD4|FMT_VIBPA Methionyl-tRNA formyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fmt PE=3 SV=1 25 267 4.0E-15
sp|B3PZF7|FMT_RHIE6 Methionyl-tRNA formyltransferase OS=Rhizobium etli (strain CIAT 652) GN=fmt PE=3 SV=1 29 264 4.0E-15
sp|C5D8R6|FMT_GEOSW Methionyl-tRNA formyltransferase OS=Geobacillus sp. (strain WCH70) GN=fmt PE=3 SV=1 109 264 5.0E-15
sp|B9DV45|FMT_STRU0 Methionyl-tRNA formyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=fmt PE=3 SV=1 30 252 5.0E-15
sp|A1SR38|FMT_PSYIN Methionyl-tRNA formyltransferase OS=Psychromonas ingrahamii (strain 37) GN=fmt PE=3 SV=1 27 267 6.0E-15
sp|Q8UID0|FMT_AGRFC Methionyl-tRNA formyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fmt PE=3 SV=1 29 264 6.0E-15
sp|C0M780|FMT_STRE4 Methionyl-tRNA formyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=fmt PE=3 SV=1 30 252 6.0E-15
sp|Q3KKE6|FMT_PSEPF Methionyl-tRNA formyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=fmt PE=3 SV=1 25 267 7.0E-15
sp|Q4KKR0|FMT_PSEF5 Methionyl-tRNA formyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fmt PE=3 SV=1 25 278 7.0E-15
sp|C0MH30|FMT_STRS7 Methionyl-tRNA formyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=fmt PE=3 SV=1 30 252 7.0E-15
sp|A7N122|FMT_VIBCB Methionyl-tRNA formyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fmt PE=3 SV=1 25 267 8.0E-15
sp|Q3J6T9|FMT_NITOC Methionyl-tRNA formyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=fmt PE=3 SV=1 25 267 8.0E-15
sp|A8AVV3|FMT_STRGC Methionyl-tRNA formyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=fmt PE=3 SV=1 30 250 8.0E-15
sp|A1JRZ2|FMT_YERE8 Methionyl-tRNA formyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fmt PE=3 SV=1 25 267 9.0E-15
sp|B0KF29|FMT_PSEPG Methionyl-tRNA formyltransferase OS=Pseudomonas putida (strain GB-1) GN=fmt PE=3 SV=1 29 267 9.0E-15
sp|Q65QF1|FMT_MANSM Methionyl-tRNA formyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fmt PE=3 SV=2 28 267 1.0E-14
sp|Q5HPX5|FMT_STAEQ Methionyl-tRNA formyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fmt PE=3 SV=1 30 279 1.0E-14
sp|A1RDX6|FMT_SHESW Methionyl-tRNA formyltransferase OS=Shewanella sp. (strain W3-18-1) GN=fmt PE=3 SV=1 29 267 1.0E-14
sp|A4VFH7|FMT_PSEU5 Methionyl-tRNA formyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=fmt PE=3 SV=1 25 267 1.0E-14
sp|Q2G493|FMT_NOVAD Methionyl-tRNA formyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=fmt PE=3 SV=1 29 266 1.0E-14
sp|A4YLC0|FMT_BRASO Methionyl-tRNA formyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=fmt PE=3 SV=1 28 286 1.0E-14
sp|B7I2C3|FMT_ACIB5 Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=fmt PE=3 SV=1 58 281 1.0E-14
sp|A5UEB3|FMT_HAEIE Methionyl-tRNA formyltransferase OS=Haemophilus influenzae (strain PittEE) GN=fmt PE=3 SV=1 29 299 1.0E-14
sp|B0TGS9|FMT_HELMI Methionyl-tRNA formyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=fmt PE=3 SV=1 29 287 1.0E-14
sp|Q9CEE9|FMT_LACLA Methionyl-tRNA formyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=fmt PE=3 SV=1 30 252 1.0E-14
sp|A0KR60|FMT_SHESA Methionyl-tRNA formyltransferase OS=Shewanella sp. (strain ANA-3) GN=fmt PE=3 SV=1 28 267 1.0E-14
sp|A9VTA4|FMT_BACWK Methionyl-tRNA formyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=fmt PE=3 SV=1 109 323 1.0E-14
sp|Q9PEV1|FMT_XYLFA Methionyl-tRNA formyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=fmt PE=3 SV=1 29 250 1.0E-14
sp|Q87AR0|FMT_XYLFT Methionyl-tRNA formyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=fmt PE=3 SV=1 29 250 1.0E-14
sp|B2I8S3|FMT_XYLF2 Methionyl-tRNA formyltransferase OS=Xylella fastidiosa (strain M23) GN=fmt PE=3 SV=1 29 250 1.0E-14
sp|Q7MYI1|FMT_PHOLL Methionyl-tRNA formyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fmt PE=3 SV=1 25 267 1.0E-14
sp|B8IFQ3|FMT_METNO Methionyl-tRNA formyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=fmt PE=3 SV=1 28 251 1.0E-14
sp|Q6D001|FMT_PECAS Methionyl-tRNA formyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fmt PE=3 SV=1 25 267 1.0E-14
sp|Q82ZD8|FMT_ENTFA Methionyl-tRNA formyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=fmt PE=3 SV=1 109 271 1.0E-14
sp|A5VWJ8|FMT_PSEP1 Methionyl-tRNA formyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fmt PE=3 SV=1 29 267 1.0E-14
sp|Q6NC50|FMT_RHOPA Methionyl-tRNA formyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=fmt PE=3 SV=1 28 286 1.0E-14
sp|Q1IH35|FMT_PSEE4 Methionyl-tRNA formyltransferase OS=Pseudomonas entomophila (strain L48) GN=fmt PE=3 SV=1 29 267 1.0E-14
sp|Q1LT57|FMT_BAUCH Methionyl-tRNA formyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=fmt PE=3 SV=1 29 301 2.0E-14
sp|Q28V76|FMT_JANSC Methionyl-tRNA formyltransferase OS=Jannaschia sp. (strain CCS1) GN=fmt PE=3 SV=1 29 250 2.0E-14
sp|C3KE47|FMT_PSEFS Methionyl-tRNA formyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=fmt PE=3 SV=1 25 267 2.0E-14
sp|Q5FJH5|FMT_LACAC Methionyl-tRNA formyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fmt PE=3 SV=1 62 243 2.0E-14
sp|B0VAE0|FMT_ACIBY Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain AYE) GN=fmt PE=3 SV=1 58 281 2.0E-14
sp|A3MAA1|FMT_ACIBT Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=fmt PE=3 SV=2 58 281 2.0E-14
sp|B7GUZ7|FMT_ACIB3 Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=fmt PE=3 SV=1 58 281 2.0E-14
sp|B8E0X6|FMT_DICTD Methionyl-tRNA formyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=fmt PE=3 SV=1 66 250 2.0E-14
sp|Q65JS5|FMT_BACLD Methionyl-tRNA formyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=fmt PE=3 SV=1 109 252 2.0E-14
sp|A4VTF3|FMT_STRSY Methionyl-tRNA formyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=fmt PE=3 SV=1 30 252 2.0E-14
sp|A4VZN1|FMT_STRS2 Methionyl-tRNA formyltransferase OS=Streptococcus suis (strain 98HAH33) GN=fmt PE=3 SV=1 30 252 2.0E-14
sp|Q3BNK7|FMT_XANC5 Methionyl-tRNA formyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fmt PE=3 SV=1 29 267 2.0E-14
sp|Q21RP5|FMT_RHOFT Methionyl-tRNA formyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=fmt PE=3 SV=1 108 266 2.0E-14
sp|Q8PG21|FMT_XANAC Methionyl-tRNA formyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fmt PE=3 SV=1 29 267 3.0E-14
sp|B7VMX2|FMT_VIBTL Methionyl-tRNA formyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=fmt PE=3 SV=1 25 267 3.0E-14
sp|B2I2H7|FMT_ACIBC Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=fmt PE=3 SV=1 58 267 3.0E-14
sp|B0T1S7|FMT_CAUSK Methionyl-tRNA formyltransferase OS=Caulobacter sp. (strain K31) GN=fmt PE=3 SV=1 29 300 4.0E-14
sp|B5Y7I0|FMT_COPPD Methionyl-tRNA formyltransferase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=fmt PE=3 SV=1 29 180 4.0E-14
sp|P44787|FMT_HAEIN Methionyl-tRNA formyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fmt PE=3 SV=1 29 299 4.0E-14
sp|Q8CSW1|FMT_STAES Methionyl-tRNA formyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fmt PE=3 SV=1 30 279 4.0E-14
sp|B5ZN20|FMT_RHILW Methionyl-tRNA formyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=fmt PE=3 SV=1 29 264 4.0E-14
sp|Q5P4H6|FMT_AROAE Methionyl-tRNA formyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=fmt PE=3 SV=1 62 280 4.0E-14
sp|Q89BP0|FMT_BRADU Methionyl-tRNA formyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fmt PE=3 SV=1 28 286 5.0E-14
sp|A8GYH2|FMT_SHEPA Methionyl-tRNA formyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fmt PE=3 SV=1 28 267 5.0E-14
sp|C3MF25|FMT_RHISN Methionyl-tRNA formyltransferase OS=Rhizobium sp. (strain NGR234) GN=fmt PE=3 SV=1 28 283 5.0E-14
sp|Q71YJ3|FMT_LISMF Methionyl-tRNA formyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=fmt PE=3 SV=1 30 252 5.0E-14
sp|C1KWC2|FMT_LISMC Methionyl-tRNA formyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=fmt PE=3 SV=1 30 252 5.0E-14
sp|B8DDS9|FMT_LISMH Methionyl-tRNA formyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=fmt PE=3 SV=1 30 252 5.0E-14
sp|B3QCH2|FMT_RHOPT Methionyl-tRNA formyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=fmt PE=3 SV=1 28 286 5.0E-14
sp|A4IM47|FMT_GEOTN Methionyl-tRNA formyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=fmt PE=3 SV=1 109 266 5.0E-14
sp|B0VQ12|FMT_ACIBS Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain SDF) GN=fmt PE=3 SV=1 58 267 5.0E-14
sp|Q67PR4|FMT_SYMTH Methionyl-tRNA formyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=fmt PE=3 SV=1 29 295 5.0E-14
sp|Q1H4Y0|FMT_METFK Methionyl-tRNA formyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=fmt PE=3 SV=1 29 267 5.0E-14
sp|Q5L0S3|FMT_GEOKA Methionyl-tRNA formyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=fmt PE=3 SV=1 109 266 6.0E-14
sp|C4L7Y3|FMT_TOLAT Methionyl-tRNA formyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=fmt PE=3 SV=1 29 267 6.0E-14
sp|Q6G5F1|FMT_BARHE Methionyl-tRNA formyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=fmt PE=3 SV=1 29 273 6.0E-14
sp|B8CWS7|FMT_HALOH Methionyl-tRNA formyltransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=fmt PE=3 SV=1 29 252 6.0E-14
sp|B0U4M3|FMT_XYLFM Methionyl-tRNA formyltransferase OS=Xylella fastidiosa (strain M12) GN=fmt PE=3 SV=1 29 250 6.0E-14
sp|Q4QMV7|FMT_HAEI8 Methionyl-tRNA formyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=fmt PE=3 SV=1 29 299 6.0E-14
sp|Q38XT6|FMT_LACSS Methionyl-tRNA formyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=fmt PE=3 SV=1 31 211 7.0E-14
sp|B9EB94|FMT_MACCJ Methionyl-tRNA formyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=fmt PE=3 SV=1 30 264 7.0E-14
sp|A1UUB5|FMT_BARBK Methionyl-tRNA formyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=fmt PE=3 SV=1 29 263 7.0E-14
sp|Q8RDM3|FMT_FUSNN Methionyl-tRNA formyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fmt PE=3 SV=2 29 280 7.0E-14
sp|B2U795|FMT_RALPJ Methionyl-tRNA formyltransferase OS=Ralstonia pickettii (strain 12J) GN=fmt PE=3 SV=1 25 252 7.0E-14
sp|B1J432|FMT_PSEPW Methionyl-tRNA formyltransferase OS=Pseudomonas putida (strain W619) GN=fmt PE=3 SV=1 29 267 8.0E-14
sp|Q11LC8|FMT_CHESB Methionyl-tRNA formyltransferase OS=Chelativorans sp. (strain BNC1) GN=fmt PE=3 SV=1 29 264 8.0E-14
sp|A4XNB2|FMT_PSEMY Methionyl-tRNA formyltransferase OS=Pseudomonas mendocina (strain ymp) GN=fmt PE=3 SV=1 27 266 8.0E-14
sp|Q0AXL4|FMT_SYNWW Methionyl-tRNA formyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=fmt PE=3 SV=1 29 252 9.0E-14
sp|A5CF64|FMT_ORITB Methionyl-tRNA formyltransferase OS=Orientia tsutsugamushi (strain Boryong) GN=fmt PE=3 SV=1 85 258 9.0E-14
sp|Q5FPX2|FMT_GLUOX Methionyl-tRNA formyltransferase OS=Gluconobacter oxydans (strain 621H) GN=fmt PE=3 SV=1 29 264 9.0E-14
sp|Q88RR2|FMT_PSEPK Methionyl-tRNA formyltransferase OS=Pseudomonas putida (strain KT2440) GN=fmt PE=3 SV=1 29 267 1.0E-13
sp|P57949|FMT_PASMU Methionyl-tRNA formyltransferase OS=Pasteurella multocida (strain Pm70) GN=fmt PE=3 SV=1 29 267 1.0E-13
sp|Q1RJ22|FMT_RICBR Methionyl-tRNA formyltransferase OS=Rickettsia bellii (strain RML369-C) GN=fmt PE=3 SV=1 29 250 1.0E-13
sp|A9FL08|FMT_SORC5 Methionyl-tRNA formyltransferase OS=Sorangium cellulosum (strain So ce56) GN=fmt PE=3 SV=1 29 289 1.0E-13
sp|Q8P4G0|FMT_XANCP Methionyl-tRNA formyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=fmt PE=3 SV=1 29 267 2.0E-13
sp|Q4UQ15|FMT_XANC8 Methionyl-tRNA formyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=fmt PE=3 SV=1 29 267 2.0E-13
sp|P0DB05|FMT_STRPQ Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=fmt PE=3 SV=1 29 264 2.0E-13
sp|P0DB04|FMT_STRP3 Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=fmt PE=3 SV=1 29 264 2.0E-13
sp|A0KEW9|FMT_AERHH Methionyl-tRNA formyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fmt PE=3 SV=1 27 251 2.0E-13
sp|Q1GWK0|FMT_SPHAL Methionyl-tRNA formyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=fmt PE=3 SV=1 29 267 2.0E-13
sp|A7Z4J3|FMT_BACMF Methionyl-tRNA formyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=fmt PE=3 SV=1 109 252 2.0E-13
sp|Q500T0|FMT_PSEU2 Methionyl-tRNA formyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fmt PE=3 SV=1 25 279 2.0E-13
sp|Q5X1U6|FMT_LEGPA Methionyl-tRNA formyltransferase OS=Legionella pneumophila (strain Paris) GN=fmt PE=3 SV=1 60 267 2.0E-13
sp|O85732|FMT_PSEAE Methionyl-tRNA formyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fmt PE=3 SV=1 25 266 2.0E-13
sp|Q5XAP4|FMT_STRP6 Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=fmt PE=3 SV=1 29 264 2.0E-13
sp|Q0VTE2|FMT_ALCBS Methionyl-tRNA formyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=fmt PE=3 SV=1 28 283 2.0E-13
sp|Q5ZSC5|FMT_LEGPH Methionyl-tRNA formyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=fmt PE=3 SV=1 60 267 2.0E-13
sp|B0TLC9|FMT_SHEHH Methionyl-tRNA formyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=fmt PE=3 SV=1 28 267 3.0E-13
sp|A5IAY3|FMT_LEGPC Methionyl-tRNA formyltransferase OS=Legionella pneumophila (strain Corby) GN=fmt PE=3 SV=1 60 267 3.0E-13
sp|B3EAP0|FMT_GEOLS Methionyl-tRNA formyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=fmt PE=3 SV=1 30 278 3.0E-13
sp|Q02V63|FMT_PSEAB Methionyl-tRNA formyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fmt PE=3 SV=1 25 266 3.0E-13
sp|Q2KD50|FMT_RHIEC Methionyl-tRNA formyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fmt PE=3 SV=1 29 264 3.0E-13
sp|B7V0Q3|FMT_PSEA8 Methionyl-tRNA formyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=fmt PE=3 SV=1 25 266 3.0E-13
sp|A6UX80|FMT_PSEA7 Methionyl-tRNA formyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=fmt PE=3 SV=1 29 278 3.0E-13
sp|B0UP41|FMT_METS4 Methionyl-tRNA formyltransferase OS=Methylobacterium sp. (strain 4-46) GN=fmt PE=3 SV=1 29 250 3.0E-13
sp|Q74IM9|FMT_LACJO Methionyl-tRNA formyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=fmt PE=3 SV=1 62 251 3.0E-13
sp|B5YF45|FMT_DICT6 Methionyl-tRNA formyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=fmt PE=3 SV=1 111 250 3.0E-13
sp|Q92AI5|FMT_LISIN Methionyl-tRNA formyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=fmt PE=3 SV=1 30 252 4.0E-13
sp|A1BHJ9|FMT_CHLPD Methionyl-tRNA formyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=fmt PE=3 SV=1 29 284 4.0E-13
sp|A1S1J8|FMT_SHEAM Methionyl-tRNA formyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fmt PE=3 SV=1 28 184 4.0E-13
sp|A0LUE0|FMT_ACIC1 Methionyl-tRNA formyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=fmt PE=3 SV=1 29 251 4.0E-13
sp|P59557|FMT_BUCBP Methionyl-tRNA formyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fmt PE=3 SV=1 27 267 4.0E-13
sp|Q2LRX4|FMT_SYNAS Methionyl-tRNA formyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=fmt PE=3 SV=1 29 273 4.0E-13
sp|Q8NX18|FMT_STAAW Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain MW2) GN=fmt PE=3 SV=1 30 301 4.0E-13
sp|Q6G9Z7|FMT_STAAS Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=fmt PE=3 SV=1 30 301 4.0E-13
sp|B2JJU4|FMT_BURP8 Methionyl-tRNA formyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=fmt PE=3 SV=1 25 266 4.0E-13
sp|Q8Y676|FMT_LISMO Methionyl-tRNA formyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=fmt PE=3 SV=1 30 252 4.0E-13
sp|Q48S21|FMT_STRPM Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=fmt PE=3 SV=1 29 250 5.0E-13
sp|Q0SS78|FMT_CLOPS Methionyl-tRNA formyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=fmt PE=3 SV=1 29 319 5.0E-13
sp|A6LCS5|FMT_PARD8 Methionyl-tRNA formyltransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=fmt PE=3 SV=1 29 299 5.0E-13
sp|Q2NQQ3|FMT_SODGM Methionyl-tRNA formyltransferase OS=Sodalis glossinidius (strain morsitans) GN=fmt PE=3 SV=1 25 267 5.0E-13
sp|B8J1H5|FMT_DESDA Methionyl-tRNA formyltransferase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=fmt PE=3 SV=1 67 264 5.0E-13
sp|Q31J85|FMT_THICR Methionyl-tRNA formyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=fmt PE=3 SV=1 25 283 5.0E-13
sp|Q2SQX2|FMT_HAHCH Methionyl-tRNA formyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=fmt PE=3 SV=1 25 283 5.0E-13
sp|A2RD70|FMT_STRPG Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=fmt PE=3 SV=1 29 264 6.0E-13
sp|Q1JKP9|FMT_STRPC Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=fmt PE=3 SV=1 29 264 6.0E-13
sp|Q1JAJ7|FMT_STRPB Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=fmt PE=3 SV=1 29 264 6.0E-13
sp|Q114P5|FMT_TRIEI Methionyl-tRNA formyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=fmt PE=3 SV=1 29 266 6.0E-13
sp|B4RDU2|FMT_PHEZH Methionyl-tRNA formyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=fmt PE=3 SV=1 29 356 6.0E-13
sp|C1CSZ4|FMT_STRZT Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=fmt PE=3 SV=1 30 252 7.0E-13
sp|Q97PA6|FMT_STRPN Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=fmt PE=3 SV=1 30 252 7.0E-13
sp|B1I7J8|FMT_STRPI Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=fmt PE=3 SV=1 30 252 7.0E-13
sp|C1C8X2|FMT_STRP7 Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=fmt PE=3 SV=1 30 252 7.0E-13
sp|P94463|FMT_BACSU Methionyl-tRNA formyltransferase OS=Bacillus subtilis (strain 168) GN=fmt PE=3 SV=2 109 264 7.0E-13
sp|C1CM71|FMT_STRZP Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=fmt PE=3 SV=1 30 252 7.0E-13
sp|C1CFV7|FMT_STRZJ Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=fmt PE=3 SV=1 30 252 7.0E-13
sp|B8ZMJ8|FMT_STRPJ Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=fmt PE=3 SV=1 30 252 7.0E-13
sp|Q1J5I9|FMT_STRPF Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=fmt PE=3 SV=1 29 264 8.0E-13
sp|Q8P003|FMT_STRP8 Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=fmt PE=3 SV=1 29 264 8.0E-13
sp|B5E782|FMT_STRP4 Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=fmt PE=3 SV=1 30 252 8.0E-13
sp|Q7VK98|FMT_HAEDU Methionyl-tRNA formyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=fmt PE=3 SV=1 29 250 8.0E-13
sp|P50932|FMT_RICPR Methionyl-tRNA formyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=fmt PE=3 SV=2 29 250 8.0E-13
sp|A0AJS8|FMT_LISW6 Methionyl-tRNA formyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=fmt PE=3 SV=1 30 252 9.0E-13
sp|Q6GHL9|FMT_STAAR Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=fmt PE=3 SV=1 30 301 9.0E-13
sp|P99127|FMT_STAAN Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain N315) GN=fmt PE=1 SV=1 30 301 9.0E-13
sp|P64136|FMT_STAAM Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fmt PE=3 SV=1 30 301 9.0E-13
sp|A5ISA1|FMT_STAA9 Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain JH9) GN=fmt PE=3 SV=1 30 301 9.0E-13
sp|A6U135|FMT_STAA2 Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain JH1) GN=fmt PE=3 SV=1 30 301 9.0E-13
sp|A7X1H4|FMT_STAA1 Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=fmt PE=3 SV=1 30 301 9.0E-13
sp|B5XMI3|FMT_STRPZ Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=fmt PE=3 SV=1 29 264 1.0E-12
sp|Q9K1K6|FMT_NEIMB Methionyl-tRNA formyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=fmt PE=3 SV=1 108 282 1.0E-12
sp|Q8XJL3|FMT_CLOPE Methionyl-tRNA formyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=fmt PE=3 SV=1 29 264 1.0E-12
sp|Q99YM7|FMT_STRP1 Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M1 GN=fmt PE=3 SV=1 29 264 1.0E-12
sp|Q2YXK0|FMT_STAAB Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=fmt PE=3 SV=1 30 301 1.0E-12
sp|A9ILK1|FMT_BART1 Methionyl-tRNA formyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=fmt PE=3 SV=1 29 267 1.0E-12
sp|Q03FY3|FMT_PEDPA Methionyl-tRNA formyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=fmt PE=3 SV=1 31 193 1.0E-12
sp|Q73M65|FMT_TREDE Methionyl-tRNA formyltransferase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=fmt PE=3 SV=1 29 266 1.0E-12
sp|Q5H5D0|FMT_XANOR Methionyl-tRNA formyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=fmt PE=3 SV=2 29 267 1.0E-12
sp|B2SL54|FMT_XANOP Methionyl-tRNA formyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=fmt PE=3 SV=1 29 267 1.0E-12
sp|Q2P825|FMT_XANOM Methionyl-tRNA formyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=fmt PE=3 SV=1 29 267 1.0E-12
sp|Q9JWY9|FMT_NEIMA Methionyl-tRNA formyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fmt PE=3 SV=1 108 282 1.0E-12
sp|Q2J2C5|FMT_RHOP2 Methionyl-tRNA formyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=fmt PE=3 SV=1 28 286 1.0E-12
sp|A8F525|FMT_PSELT Methionyl-tRNA formyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=fmt PE=3 SV=1 29 252 1.0E-12
sp|Q8Y3A8|FMT_RALSO Methionyl-tRNA formyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=fmt PE=3 SV=1 109 256 1.0E-12
sp|B9J8C6|FMT_AGRRK Methionyl-tRNA formyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=fmt PE=3 SV=1 29 264 1.0E-12
sp|Q3AC19|FMT_CARHZ Methionyl-tRNA formyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=fmt PE=3 SV=1 29 251 2.0E-12
sp|O33582|FMT_RICTY Methionyl-tRNA formyltransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fmt PE=3 SV=2 90 250 2.0E-12
sp|B2RM92|FMT_PORG3 Methionyl-tRNA formyltransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=fmt PE=3 SV=1 26 361 2.0E-12
sp|Q2T2B1|FMT_BURTA Methionyl-tRNA formyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fmt PE=3 SV=1 109 266 2.0E-12
sp|Q55163|FMT_SYNY3 Methionyl-tRNA formyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fmt PE=3 SV=1 29 267 2.0E-12
sp|Q8DNR7|FMT_STRR6 Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fmt PE=3 SV=1 30 252 2.0E-12
sp|B2IS85|FMT_STRPS Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=fmt PE=3 SV=1 30 252 2.0E-12
sp|Q04J40|FMT_STRP2 Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=fmt PE=3 SV=1 30 252 2.0E-12
sp|A5EWL9|FMT_DICNV Methionyl-tRNA formyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=fmt PE=3 SV=1 30 266 2.0E-12
sp|Q8DVK4|FMT_STRMU Methionyl-tRNA formyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fmt PE=3 SV=2 30 252 2.0E-12
sp|B2V969|FMT_SULSY Methionyl-tRNA formyltransferase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=fmt PE=3 SV=1 29 270 2.0E-12
sp|A4SFP1|FMT_CHLPM Methionyl-tRNA formyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=fmt PE=3 SV=1 28 360 2.0E-12
sp|B1HQE4|FMT_LYSSC Methionyl-tRNA formyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=fmt PE=3 SV=1 31 256 2.0E-12
sp|B1YPX6|FMT_BURA4 Methionyl-tRNA formyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=fmt PE=3 SV=1 29 266 2.0E-12
sp|A1KRE6|FMT_NEIMF Methionyl-tRNA formyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=fmt PE=3 SV=1 108 282 2.0E-12
sp|B0BWL1|FMT_RICRO Methionyl-tRNA formyltransferase OS=Rickettsia rickettsii (strain Iowa) GN=fmt PE=3 SV=1 29 250 2.0E-12
sp|C4K0Y8|FMT_RICPU Methionyl-tRNA formyltransferase OS=Rickettsia peacockii (strain Rustic) GN=fmt PE=3 SV=1 29 250 2.0E-12
sp|A4JJ22|FMT_BURVG Methionyl-tRNA formyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=fmt PE=3 SV=1 29 266 2.0E-12
sp|B2VK94|FMT_ERWT9 Methionyl-tRNA formyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=fmt PE=3 SV=1 25 267 2.0E-12
sp|A4J579|FMT_DESRM Methionyl-tRNA formyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=fmt PE=3 SV=1 29 264 3.0E-12
sp|Q5WTK7|FMT_LEGPL Methionyl-tRNA formyltransferase OS=Legionella pneumophila (strain Lens) GN=fmt PE=3 SV=1 60 267 3.0E-12
sp|C1F542|FMT_ACIC5 Methionyl-tRNA formyltransferase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=fmt PE=3 SV=1 29 285 3.0E-12
sp|B8HUR2|FMT_CYAP4 Methionyl-tRNA formyltransferase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=fmt PE=3 SV=1 29 252 3.0E-12
sp|A9AC69|FMT_BURM1 Methionyl-tRNA formyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=fmt PE=3 SV=1 109 266 3.0E-12
sp|Q5F5P7|FMT_NEIG1 Methionyl-tRNA formyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fmt PE=3 SV=1 108 282 3.0E-12
sp|Q3SMS3|FMT_THIDA Methionyl-tRNA formyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=fmt PE=3 SV=1 58 336 3.0E-12
sp|Q8ER25|FMT_OCEIH Methionyl-tRNA formyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=fmt PE=3 SV=1 109 252 3.0E-12
sp|A1WZH3|FMT_HALHL Methionyl-tRNA formyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=fmt PE=3 SV=1 30 208 4.0E-12
sp|O33523|FMT_RICFE Methionyl-tRNA formyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fmt PE=3 SV=2 107 250 4.0E-12
sp|A8Z3Q2|FMT_STAAT Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=fmt PE=3 SV=1 30 301 4.0E-12
sp|A6QGB6|FMT_STAAE Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain Newman) GN=fmt PE=3 SV=1 30 301 4.0E-12
sp|Q5HGL6|FMT_STAAC Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain COL) GN=fmt PE=3 SV=1 30 301 4.0E-12
sp|Q2FZ68|FMT_STAA8 Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=fmt PE=3 SV=1 30 301 4.0E-12
sp|Q2FHM2|FMT_STAA3 Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain USA300) GN=fmt PE=3 SV=1 30 301 4.0E-12
sp|A1VU45|FMT_POLNA Methionyl-tRNA formyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=fmt PE=3 SV=1 29 266 4.0E-12
sp|Q147A4|FMT_BURXL Methionyl-tRNA formyltransferase OS=Burkholderia xenovorans (strain LB400) GN=fmt PE=3 SV=1 109 266 5.0E-12
sp|B9DPM5|FMT_STACT Methionyl-tRNA formyltransferase OS=Staphylococcus carnosus (strain TM300) GN=fmt PE=3 SV=1 30 264 5.0E-12
sp|Q3AK21|FMT_SYNSC Methionyl-tRNA formyltransferase OS=Synechococcus sp. (strain CC9605) GN=fmt PE=3 SV=1 29 351 5.0E-12
sp|A9M463|FMT_NEIM0 Methionyl-tRNA formyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=fmt PE=3 SV=1 108 282 5.0E-12
sp|B5ED77|FMT_GEOBB Methionyl-tRNA formyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=fmt PE=3 SV=1 29 252 5.0E-12
sp|Q1JFP0|FMT_STRPD Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=fmt PE=3 SV=1 29 264 5.0E-12
sp|Q3SN28|FMT_NITWN Methionyl-tRNA formyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=fmt PE=3 SV=1 28 286 5.0E-12
sp|Q2JK54|FMT_SYNJB Methionyl-tRNA formyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=fmt PE=3 SV=1 29 266 5.0E-12
sp|Q0BAT6|FMT_BURCM Methionyl-tRNA formyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=fmt PE=3 SV=1 29 266 5.0E-12
sp|Q7MTE3|FMT_PORGI Methionyl-tRNA formyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=fmt PE=3 SV=1 26 361 5.0E-12
sp|B4RPX5|FMT_NEIG2 Methionyl-tRNA formyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=fmt PE=3 SV=1 108 282 5.0E-12
sp|Q044H0|FMT_LACGA Methionyl-tRNA formyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fmt PE=3 SV=1 62 248 5.0E-12
sp|Q6F155|FMT_MESFL Methionyl-tRNA formyltransferase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=fmt PE=3 SV=1 27 275 6.0E-12
sp|B2T1K6|FMT_BURPP Methionyl-tRNA formyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=fmt PE=3 SV=1 109 266 7.0E-12
sp|C5BF18|FMT_EDWI9 Methionyl-tRNA formyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=fmt PE=3 SV=1 25 250 7.0E-12
sp|A8FD38|FMT_BACP2 Methionyl-tRNA formyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=fmt PE=3 SV=1 109 252 7.0E-12
sp|Q5WFK7|FMT_BACSK Methionyl-tRNA formyltransferase OS=Bacillus clausii (strain KSM-K16) GN=fmt PE=3 SV=1 109 252 7.0E-12
sp|Q8K974|FMT_BUCAP Methionyl-tRNA formyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fmt PE=3 SV=1 29 267 7.0E-12
sp|Q5NPC5|FMT_ZYMMO Methionyl-tRNA formyltransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=fmt PE=3 SV=1 29 290 8.0E-12
sp|Q3ATB5|FMT_CHLCH Methionyl-tRNA formyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=fmt PE=3 SV=1 82 357 8.0E-12
sp|Q88WL3|FMT_LACPL Methionyl-tRNA formyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=fmt PE=3 SV=1 31 184 8.0E-12
sp|A8F0W5|FMT_RICM5 Methionyl-tRNA formyltransferase OS=Rickettsia massiliae (strain Mtu5) GN=fmt PE=3 SV=1 107 250 9.0E-12
sp|B3EE18|FMT_CHLL2 Methionyl-tRNA formyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=fmt PE=3 SV=1 29 271 9.0E-12
sp|O33519|FMT_RICCN Methionyl-tRNA formyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fmt PE=3 SV=2 29 250 9.0E-12
sp|C3PMQ0|FMT_RICAE Methionyl-tRNA formyltransferase OS=Rickettsia africae (strain ESF-5) GN=fmt PE=3 SV=1 29 250 9.0E-12
sp|B7IFU7|FMT_THEAB Methionyl-tRNA formyltransferase OS=Thermosipho africanus (strain TCF52B) GN=fmt PE=3 SV=1 29 258 9.0E-12
sp|A2BWG3|FMT_PROM5 Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=fmt PE=3 SV=1 29 266 1.0E-11
sp|Q13F19|FMT_RHOPS Methionyl-tRNA formyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=fmt PE=3 SV=1 28 286 1.0E-11
sp|A1WD32|FMT_ACISJ Methionyl-tRNA formyltransferase OS=Acidovorax sp. (strain JS42) GN=fmt PE=3 SV=1 109 266 2.0E-11
sp|Q3AXQ4|FMT_SYNS9 Methionyl-tRNA formyltransferase OS=Synechococcus sp. (strain CC9902) GN=fmt PE=3 SV=1 29 267 2.0E-11
sp|O33520|FMT_RICCK Methionyl-tRNA formyltransferase OS=Rickettsia canadensis (strain McKiel) GN=fmt PE=3 SV=2 106 250 2.0E-11
sp|B9MI87|FMT_ACIET Methionyl-tRNA formyltransferase OS=Acidovorax ebreus (strain TPSY) GN=fmt PE=3 SV=1 109 266 2.0E-11
sp|Q4JVI0|FMT_CORJK Methionyl-tRNA formyltransferase OS=Corynebacterium jeikeium (strain K411) GN=fmt PE=3 SV=1 29 252 2.0E-11
sp|Q39BU5|FMT_BURL3 Methionyl-tRNA formyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=fmt PE=3 SV=1 29 266 2.0E-11
sp|Q7VQC1|FMT_BLOFL Methionyl-tRNA formyltransferase OS=Blochmannia floridanus GN=fmt PE=3 SV=1 107 267 2.0E-11
sp|A0KBJ7|FMT_BURCH Methionyl-tRNA formyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=fmt PE=3 SV=1 109 310 2.0E-11
sp|Q1BSJ4|FMT_BURCA Methionyl-tRNA formyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=fmt PE=3 SV=1 109 310 2.0E-11
sp|A0Q626|FMT_FRATN Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=fmt PE=3 SV=1 29 266 2.0E-11
sp|B3CLK1|FMT_WOLPP Methionyl-tRNA formyltransferase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=fmt PE=3 SV=1 109 213 3.0E-11
sp|Q493I2|FMT_BLOPB Methionyl-tRNA formyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=fmt PE=3 SV=1 75 250 3.0E-11
sp|B3WEW9|FMT_LACCB Methionyl-tRNA formyltransferase OS=Lactobacillus casei (strain BL23) GN=fmt PE=3 SV=1 31 197 3.0E-11
sp|B1XW99|FMT_LEPCP Methionyl-tRNA formyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=fmt PE=3 SV=1 29 266 3.0E-11
sp|B6IPI1|FMT_RHOCS Methionyl-tRNA formyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=fmt PE=3 SV=1 29 266 3.0E-11
sp|Q1QH77|FMT_NITHX Methionyl-tRNA formyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=fmt PE=3 SV=1 28 286 3.0E-11
sp|A0L3X7|FMT_MAGMM Methionyl-tRNA formyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=fmt PE=3 SV=1 30 169 3.0E-11
sp|B8D822|FMT_BUCAT Methionyl-tRNA formyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=fmt PE=3 SV=1 29 315 3.0E-11
sp|P57564|FMT_BUCAI Methionyl-tRNA formyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fmt PE=3 SV=1 29 315 3.0E-11
sp|B8D9S0|FMT_BUCA5 Methionyl-tRNA formyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=fmt PE=3 SV=1 29 315 3.0E-11
sp|Q6ME71|FMT_PARUW Methionyl-tRNA formyltransferase OS=Protochlamydia amoebophila (strain UWE25) GN=fmt PE=3 SV=1 29 358 3.0E-11
sp|B4E7V8|FMT_BURCJ Methionyl-tRNA formyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=fmt PE=3 SV=1 109 266 4.0E-11
sp|Q63YR6|FMT_BURPS Methionyl-tRNA formyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=fmt PE=3 SV=1 109 266 4.0E-11
sp|Q9RRQ3|FMT_DEIRA Methionyl-tRNA formyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=fmt PE=3 SV=1 30 251 4.0E-11
sp|Q62MT4|FMT_BURMA Methionyl-tRNA formyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=fmt PE=3 SV=1 109 266 4.0E-11
sp|Q1AVZ9|FMT_RUBXD Methionyl-tRNA formyltransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=fmt PE=3 SV=1 109 252 4.0E-11
sp|Q1QTJ4|FMT_CHRSD Methionyl-tRNA formyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fmt PE=3 SV=1 67 252 4.0E-11
sp|A3N4D4|FMT_BURP6 Methionyl-tRNA formyltransferase OS=Burkholderia pseudomallei (strain 668) GN=fmt PE=3 SV=1 109 266 5.0E-11
sp|A3NQ23|FMT_BURP0 Methionyl-tRNA formyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=fmt PE=3 SV=1 109 266 5.0E-11
sp|Q5PBC7|FMT_ANAMM Methionyl-tRNA formyltransferase OS=Anaplasma marginale (strain St. Maries) GN=fmt PE=3 SV=1 29 184 5.0E-11
sp|Q3JXE1|FMT_BURP1 Methionyl-tRNA formyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=fmt PE=3 SV=1 109 266 5.0E-11
sp|B9JQX1|FMT_AGRVS Methionyl-tRNA formyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=fmt PE=3 SV=1 29 304 5.0E-11
sp|A4IXN6|FMT_FRATW Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=fmt PE=3 SV=1 29 266 6.0E-11
sp|Q5NGC1|FMT_FRATT Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=fmt PE=3 SV=1 29 266 6.0E-11
sp|Q14HS3|FMT_FRAT1 Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=fmt PE=3 SV=1 29 266 6.0E-11
sp|Q038H3|FMT_LACC3 Methionyl-tRNA formyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=fmt PE=3 SV=1 31 197 7.0E-11
sp|B4U5Z8|FMT_HYDS0 Methionyl-tRNA formyltransferase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=fmt PE=3 SV=1 29 207 7.0E-11
sp|A5GBL0|FMT_GEOUR Methionyl-tRNA formyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=fmt PE=3 SV=1 29 283 7.0E-11
sp|B2SGG5|FMT_FRATM Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=fmt PE=3 SV=1 29 266 7.0E-11
sp|A6SU87|FMT_JANMA Methionyl-tRNA formyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=fmt PE=3 SV=1 109 292 7.0E-11
sp|B6YQF1|FMT_AZOPC Methionyl-tRNA formyltransferase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=fmt PE=3 SV=1 30 278 8.0E-11
sp|Q0BLC5|FMT_FRATO Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=fmt PE=3 SV=1 29 178 8.0E-11
sp|Q2A2U6|FMT_FRATH Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=fmt PE=3 SV=1 29 178 8.0E-11
sp|A7NCY0|FMT_FRATF Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=fmt PE=3 SV=1 29 178 8.0E-11
sp|Q73GR6|FMT_WOLPM Methionyl-tRNA formyltransferase OS=Wolbachia pipientis wMel GN=fmt PE=3 SV=1 109 180 8.0E-11
sp|Q7TUA3|FMT_PROMP Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fmt PE=3 SV=1 29 266 9.0E-11
sp|B5YIL6|FMT_THEYD Methionyl-tRNA formyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=fmt PE=3 SV=1 31 250 1.0E-10
sp|Q2WAS9|FMT_MAGSA Methionyl-tRNA formyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=fmt PE=3 SV=1 66 270 1.0E-10
sp|Q049P0|FMT_LACDB Methionyl-tRNA formyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=fmt PE=3 SV=1 60 184 1.0E-10
sp|Q3Z614|FMT_DEHM1 Methionyl-tRNA formyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=fmt PE=3 SV=1 29 286 1.0E-10
sp|A5CRW8|FMT_CLAM3 Methionyl-tRNA formyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=fmt PE=3 SV=1 29 252 1.0E-10
sp|B1K0J5|FMT_BURCC Methionyl-tRNA formyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=fmt PE=3 SV=1 109 266 1.0E-10
sp|Q47R04|FMT_THEFY Methionyl-tRNA formyltransferase OS=Thermobifida fusca (strain YX) GN=fmt PE=3 SV=1 29 250 1.0E-10
sp|A9BS67|FMT_DELAS Methionyl-tRNA formyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=fmt PE=3 SV=1 109 266 1.0E-10
sp|A5FPB5|FMT_DEHMB Methionyl-tRNA formyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=fmt PE=3 SV=1 25 290 1.0E-10
sp|A4T0M5|FMT_POLSQ Methionyl-tRNA formyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=fmt PE=3 SV=1 29 251 2.0E-10
sp|Q5QXI6|FMT_IDILO Methionyl-tRNA formyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fmt PE=3 SV=1 29 267 2.0E-10
sp|Q8R9T1|FMT_CALS4 Methionyl-tRNA formyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=fmt PE=3 SV=1 29 250 2.0E-10
sp|C4ZEV8|FMT_EUBR3 Methionyl-tRNA formyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=fmt PE=3 SV=1 29 273 2.0E-10
sp|A1WQ79|FMT_VEREI Methionyl-tRNA formyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=fmt PE=3 SV=1 109 251 2.0E-10
sp|B3EPG6|FMT_CHLPB Methionyl-tRNA formyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=fmt PE=3 SV=1 109 295 2.0E-10
sp|C0R3S7|FMT_WOLWR Methionyl-tRNA formyltransferase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=fmt PE=3 SV=1 109 180 2.0E-10
sp|A6WCA9|FMT_KINRD Methionyl-tRNA formyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=fmt PE=3 SV=1 29 264 2.0E-10
sp|Q39QC2|FMT_GEOMG Methionyl-tRNA formyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=fmt PE=3 SV=1 29 252 2.0E-10
sp|A2SCF7|FMT_METPP Methionyl-tRNA formyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=fmt PE=3 SV=1 106 266 2.0E-10
sp|Q3ZZW0|FMT_DEHMC Methionyl-tRNA formyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=fmt PE=3 SV=1 27 290 2.0E-10
sp|A9BAJ3|FMT_PROM4 Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus (strain MIT 9211) GN=fmt PE=3 SV=1 29 263 2.0E-10
sp|B7KHD0|FMT_CYAP7 Methionyl-tRNA formyltransferase OS=Cyanothece sp. (strain PCC 7424) GN=fmt PE=3 SV=1 29 266 3.0E-10
sp|Q7NQ76|FMT_CHRVO Methionyl-tRNA formyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=fmt PE=3 SV=1 29 251 3.0E-10
sp|Q0A5C0|FMT_ALKEH Methionyl-tRNA formyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=fmt PE=3 SV=1 83 283 3.0E-10
sp|B0U0T8|FMT_FRAP2 Methionyl-tRNA formyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=fmt PE=3 SV=1 29 266 3.0E-10
sp|Q3B2V0|FMT_CHLL7 Methionyl-tRNA formyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=fmt PE=3 SV=1 29 264 4.0E-10
sp|B1XP50|FMT_SYNP2 Methionyl-tRNA formyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=fmt PE=3 SV=1 29 293 4.0E-10
sp|Q8NQ47|FMT_CORGL Methionyl-tRNA formyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=fmt PE=3 SV=1 29 276 4.0E-10
sp|A4QEH4|FMT_CORGB Methionyl-tRNA formyltransferase OS=Corynebacterium glutamicum (strain R) GN=fmt PE=3 SV=1 29 276 4.0E-10
sp|Q7VBU5|FMT_PROMA Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=fmt PE=3 SV=1 60 177 5.0E-10
sp|Q2J845|FMT_FRASC Methionyl-tRNA formyltransferase OS=Frankia sp. (strain CcI3) GN=fmt PE=3 SV=1 29 271 5.0E-10
sp|Q0BUB3|FMT_GRABC Methionyl-tRNA formyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=fmt PE=3 SV=1 29 252 6.0E-10
sp|B9M2D5|FMT_GEODF Methionyl-tRNA formyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=fmt PE=3 SV=1 29 283 7.0E-10
sp|A1ALC4|FMT_PELPD Methionyl-tRNA formyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=fmt PE=3 SV=1 31 252 7.0E-10
sp|Q46KX0|FMT_PROMT Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=fmt PE=3 SV=1 29 252 8.0E-10
sp|A2C296|FMT_PROM1 Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=fmt PE=3 SV=1 29 252 8.0E-10
sp|O87726|FMT_VIBAL Methionyl-tRNA formyltransferase (Fragment) OS=Vibrio alginolyticus GN=fmt PE=3 SV=1 107 304 8.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016742 hydroxymethyl-, formyl- and related transferase activity Yes
GO:0009058 biosynthetic process Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup945
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1634
Ophiocordyceps australis map64 (Brazil) OphauB2|2466
Ophiocordyceps camponoti-floridani Ophcf2|05500
Ophiocordyceps camponoti-rufipedis Ophun1|1150 (this protein)
Ophiocordyceps kimflemingae Ophio5|7734
Ophiocordyceps subramaniannii Hirsu2|6889

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1150
MLLLSRARPVAFKHRLSPRRWLQTVSDPLRILFCGSDLMSCKSLCALHRELGPGRLVESLEVMVLPPGRVGRGGK
ELREVTCKTVAEGLKLPIHQRGTFTGWEVPAGTNLIVVVSFGLFVPPRILRSVKYGGVNVHPSFLPDLRGPAPIH
RAMLRGDSHLGVSLQTLHESRFDHGVVLAQTPAPGLMIQDCIGGVMSMAAEEGAQMLVRGLRQGLHVPPHRDAGW
KGVELEGQTLMHAPKVTKADSQIDWARWTTVGDFHRHLRVFGSVWTHVVSSMGQIRRLILRHVQRVPEDEDPVGI
EGTICFQQDGADGATRRDMTARVDRNSGNCAVRLGSGGVWLRFDSAKMEGKNWQDAAQALGPLLSGGVGREKGGS
AARG*
Coding >Ophun1|1150
ATGCTGCTGCTATCCCGAGCCCGGCCTGTCGCTTTCAAGCATCGGCTTTCCCCGCGAAGGTGGCTCCAGACGGTG
TCGGATCCGCTGAGGATCCTGTTCTGCGGGTCAGACCTGATGAGCTGCAAATCGCTGTGCGCTCTGCACAGGGAG
CTCGGTCCTGGCCGTCTGGTCGAGTCTTTGGAAGTTATGGTGCTGCCCCCAGGCAGGGTGGGTCGGGGGGGAAAG
GAGCTTCGAGAGGTCACCTGCAAGACTGTGGCTGAGGGGTTGAAACTGCCCATTCATCAGCGGGGGACCTTTACT
GGTTGGGAGGTACCGGCGGGGACGAACCTGATTGTCGTGGTATCCTTTGGTCTGTTTGTGCCGCCGAGGATCCTT
CGTTCTGTCAAGTACGGGGGCGTCAACGTCCATCCGTCCTTTCTCCCAGACCTTCGCGGGCCGGCGCCCATTCAC
CGTGCCATGCTCCGTGGGGACAGTCACCTTGGCGTTTCTCTACAGACGCTCCATGAGAGTCGCTTCGACCACGGC
GTTGTCCTCGCCCAGACGCCCGCTCCCGGCCTGATGATCCAGGATTGTATCGGGGGCGTCATGAGCATGGCAGCG
GAAGAGGGCGCCCAGATGCTCGTCCGAGGCCTACGTCAGGGCCTGCACGTTCCTCCTCACCGGGATGCTGGCTGG
AAGGGAGTTGAGCTGGAGGGGCAAACGCTGATGCACGCGCCCAAGGTGACCAAGGCCGACAGCCAGATTGACTGG
GCGAGGTGGACGACGGTAGGCGATTTTCACCGCCATCTCCGTGTCTTTGGTTCGGTGTGGACGCATGTCGTCTCC
TCAATGGGCCAGATACGGCGTCTCATCTTGCGGCATGTACAGCGGGTGCCGGAAGACGAAGACCCCGTCGGCATC
GAGGGAACCATCTGCTTCCAGCAAGATGGCGCGGATGGGGCGACGAGACGGGACATGACCGCCAGAGTAGACCGG
AACTCGGGAAACTGTGCCGTCCGATTGGGCTCGGGAGGCGTCTGGCTGCGCTTCGATTCAGCCAAGATGGAGGGC
AAGAACTGGCAGGATGCTGCCCAGGCGCTCGGCCCTTTACTCTCTGGGGGCGTGGGAAGAGAAAAGGGGGGGTCT
GCGGCCAGAGGATGA
Transcript >Ophun1|1150
ATGCTGCTGCTATCCCGAGCCCGGCCTGTCGCTTTCAAGCATCGGCTTTCCCCGCGAAGGTGGCTCCAGACGGTG
TCGGATCCGCTGAGGATCCTGTTCTGCGGGTCAGACCTGATGAGCTGCAAATCGCTGTGCGCTCTGCACAGGGAG
CTCGGTCCTGGCCGTCTGGTCGAGTCTTTGGAAGTTATGGTGCTGCCCCCAGGCAGGGTGGGTCGGGGGGGAAAG
GAGCTTCGAGAGGTCACCTGCAAGACTGTGGCTGAGGGGTTGAAACTGCCCATTCATCAGCGGGGGACCTTTACT
GGTTGGGAGGTACCGGCGGGGACGAACCTGATTGTCGTGGTATCCTTTGGTCTGTTTGTGCCGCCGAGGATCCTT
CGTTCTGTCAAGTACGGGGGCGTCAACGTCCATCCGTCCTTTCTCCCAGACCTTCGCGGGCCGGCGCCCATTCAC
CGTGCCATGCTCCGTGGGGACAGTCACCTTGGCGTTTCTCTACAGACGCTCCATGAGAGTCGCTTCGACCACGGC
GTTGTCCTCGCCCAGACGCCCGCTCCCGGCCTGATGATCCAGGATTGTATCGGGGGCGTCATGAGCATGGCAGCG
GAAGAGGGCGCCCAGATGCTCGTCCGAGGCCTACGTCAGGGCCTGCACGTTCCTCCTCACCGGGATGCTGGCTGG
AAGGGAGTTGAGCTGGAGGGGCAAACGCTGATGCACGCGCCCAAGGTGACCAAGGCCGACAGCCAGATTGACTGG
GCGAGGTGGACGACGGTAGGCGATTTTCACCGCCATCTCCGTGTCTTTGGTTCGGTGTGGACGCATGTCGTCTCC
TCAATGGGCCAGATACGGCGTCTCATCTTGCGGCATGTACAGCGGGTGCCGGAAGACGAAGACCCCGTCGGCATC
GAGGGAACCATCTGCTTCCAGCAAGATGGCGCGGATGGGGCGACGAGACGGGACATGACCGCCAGAGTAGACCGG
AACTCGGGAAACTGTGCCGTCCGATTGGGCTCGGGAGGCGTCTGGCTGCGCTTCGATTCAGCCAAGATGGAGGGC
AAGAACTGGCAGGATGCTGCCCAGGCGCTCGGCCCTTTACTCTCTGGGGGCGTGGGAAGAGAAAAGGGGGGGTCT
GCGGCCAGAGGATGA
Gene >Ophun1|1150
ATGCTGCTGCTATCCCGAGCCCGGCCTGTCGCTTTCAAGCATCGGCTTTCCCCGCGAAGGTGGCTCCAGACGGTG
TCGGATCCGCTGAGGATCCTGTTCTGCGGGTCAGACCTGATGAGCTGCAAATCGCTGTGCGCTCTGCACAGGGAG
CTCGGTCCTGGCCGTCTGGTCGAGTCTTTGGAAGTTATGGTGCTGCCCCCAGGCAGGGTGGGTCGGGGGGGAAAG
GAGCTTCGAGAGGGTTGGTGTCTCTTCTTCCTTATAATGCCGTGTCTTATACATGGGAGAACTTGTGCTGTGATT
GCTCATTCGTTTTCTCTCCGACAGTCACCTGCAAGACTGTGGCTGAGGGGTTGAAACTGCCCATTCATCAGCGGG
GGACCTTTACTGGTTGGGAGGTGAGCTTTGCCAGATGTCATGCGGCTTTCCCGGACGCTGAGACGCCCTCTGGCT
GCTTAGGTACCGGCGGGGACGAACCTGATTGTCGTGGTATCCTTTGGTCTGTTTGTGCCGCCGAGGATCCTTCGT
TCTGTCAAGTACGGGGGCGTCAACGTCCATCCGTCCTTTCTCCCAGAGTGAGTCAAGGGCAGACCATGGACCGAG
TCAGAGGGTAACGATCGACAGCCTTCGCGGGCCGGCGCCCATTCACCGTGCCATGCTCCGTGGGGACAGTCACCT
TGGCGTTTCTCTACAGACGCTCCATGAGAGTCGCTTCGACCACGGCGTTGTCCTCGCCCAGACGCCCGCTCCCGG
CCTGATGATCCAGGATTGTATCGGGGGCGTCATGAGCATGGCAGCGGAAGAGGGCGCCCAGATGCTCGTCCGAGG
CCTACGTCAGGGCCTGCACGTTCCTCCTCACCGGGATGCTGGCTGGAAGGGAGTTGAGCTGGAGGGGCAAACGCT
GATGCACGCGCCCAAGGTGACCAAGGCCGACAGCCAGATTGACTGGGCGAGGTGGACGACGGTAGGCGATTTTCA
CCGCCATCTCCGTGTCTTTGGTTCGGTGTGGACGCATGTCGTCTCCTCAATGGGCCAGATACGGCGTCTCATCTT
GCGGCATGTACAGCGGGTGCCGGAAGACGAAGACCCCGTCGGCATCGAGGGAACCATCTGCTTCCAGCAAGATGG
CGCGGATGGGGCGACGAGACGGGACATGACCGCCAGAGTAGACCGGAACTCGGGAAACTGTGCCGTCCGATTGGG
CTCGGGAGGCGTCTGGCTGCGCTTCGATTCAGCCAAGATGGAGGGCAAGAACTGGCAGGATGCTGCCCAGGCGCT
CGGCCCTTTACTCTCTGGGGGCGTGGGAAGAGAAAAGGGGGGGTCTGCGGCCAGAGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail