Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1146
Gene name
LocationContig_143:16963..20036
Strand+
Gene length (bp)3073
Transcript length (bp)2511
Coding sequence length (bp)2511
Protein length (aa) 837

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 3.4E-23 727 802
PF04408 HA2 Helicase associated domain (HA2) 5.2E-17 572 660
PF00271 Helicase_C Helicase conserved C-terminal domain 2.9E-10 369 509
PF00270 DEAD DEAD/DEAH box helicase 2.0E-07 186 332

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 106 818 0.0E+00
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 128 828 0.0E+00
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 148 836 0.0E+00
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 148 836 0.0E+00
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 148 830 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 106 818 0.0E+00
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 128 828 0.0E+00
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 148 836 0.0E+00
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 148 836 0.0E+00
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 148 830 0.0E+00
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 148 830 0.0E+00
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 148 830 0.0E+00
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 148 819 0.0E+00
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 156 810 0.0E+00
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 162 805 0.0E+00
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 162 807 0.0E+00
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 116 807 0.0E+00
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 116 807 0.0E+00
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 264 724 0.0E+00
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 112 805 0.0E+00
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 162 821 0.0E+00
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 164 813 0.0E+00
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 155 830 0.0E+00
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 155 830 0.0E+00
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 162 812 0.0E+00
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 157 826 0.0E+00
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 165 821 0.0E+00
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 166 805 0.0E+00
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 160 813 0.0E+00
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 145 836 0.0E+00
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 118 821 0.0E+00
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 162 807 0.0E+00
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 162 825 0.0E+00
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 162 807 0.0E+00
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 134 807 0.0E+00
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 162 807 0.0E+00
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 146 805 0.0E+00
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 148 809 0.0E+00
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 148 809 0.0E+00
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 78 804 9.0E-172
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 162 807 4.0E-168
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 162 814 2.0E-165
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 148 805 2.0E-165
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 166 805 5.0E-165
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 147 809 2.0E-164
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 166 805 6.0E-164
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 168 803 2.0E-154
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 168 833 7.0E-148
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 169 833 3.0E-147
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 168 833 1.0E-146
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 169 833 2.0E-146
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 142 805 4.0E-142
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 162 801 2.0E-140
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 142 819 2.0E-139
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 166 797 9.0E-138
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 148 805 1.0E-135
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 168 801 2.0E-122
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 146 823 4.0E-122
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 168 801 1.0E-119
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 146 820 4.0E-106
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 146 820 8.0E-106
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 162 801 2.0E-101
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 164 802 4.0E-101
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 166 709 7.0E-99
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 150 709 4.0E-98
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 158 802 7.0E-98
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 158 798 2.0E-89
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 153 798 9.0E-88
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 148 792 2.0E-83
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 150 736 8.0E-74
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 166 702 5.0E-73
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 161 801 8.0E-73
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 153 671 5.0E-70
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 169 668 7.0E-68
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 155 766 5.0E-67
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 162 765 6.0E-67
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 162 765 7.0E-67
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 162 765 2.0E-66
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 158 736 2.0E-66
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 169 668 7.0E-66
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 169 668 2.0E-65
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 169 668 2.0E-65
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 169 668 3.0E-65
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 132 715 6.0E-65
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 169 668 2.0E-64
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 162 765 5.0E-64
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 122 736 5.0E-62
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 148 667 7.0E-61
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 151 746 3.0E-60
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 157 736 4.0E-60
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 154 692 1.0E-59
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 154 692 1.0E-59
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 169 736 4.0E-59
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 168 611 5.0E-59
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 155 692 7.0E-59
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 151 693 9.0E-59
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 169 720 3.0E-57
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 154 692 6.0E-57
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 160 709 7.0E-57
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 160 692 3.0E-56
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 168 669 1.0E-55
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 168 747 2.0E-55
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 168 747 2.0E-55
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 154 692 4.0E-55
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 348 798 6.0E-53
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 155 407 1.0E-49
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 164 623 5.0E-48
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 361 792 1.0E-47
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 414 808 2.0E-46
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 162 400 2.0E-46
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 162 402 7.0E-46
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 361 792 1.0E-45
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 157 350 3.0E-45
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 281 791 3.0E-45
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 367 798 4.0E-45
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 137 354 1.0E-44
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 414 634 1.0E-44
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 166 353 6.0E-44
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 161 366 6.0E-44
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 128 354 3.0E-43
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 370 794 1.0E-42
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 402 801 2.0E-42
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 164 598 2.0E-42
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 164 598 3.0E-42
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 164 598 3.0E-42
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 164 598 3.0E-42
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 164 598 3.0E-42
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 164 400 4.0E-42
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 51 365 6.0E-42
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 138 354 1.0E-41
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 152 357 1.0E-40
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 168 547 2.0E-40
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 154 354 3.0E-40
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 161 709 6.0E-40
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 404 807 8.0E-40
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 130 354 6.0E-39
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 379 794 1.0E-38
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 379 794 1.0E-38
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 162 400 3.0E-38
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 166 352 6.0E-38
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 166 352 6.0E-38
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 151 354 9.0E-38
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 162 354 3.0E-37
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 370 717 2.0E-36
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 355 785 6.0E-36
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 380 794 1.0E-35
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 379 794 2.0E-35
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 355 711 2.0E-35
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 380 794 4.0E-35
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 375 806 7.0E-35
sp|Q5UR20|YR366_MIMIV Putative ATP-dependent RNA helicase R366 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R366 PE=3 SV=1 177 549 1.0E-28
sp|Q98218|NPH2_MCV1 RNA helicase NPH-II OS=Molluscum contagiosum virus subtype 1 GN=NPH2 PE=3 SV=1 288 518 7.0E-11
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 527 794 5.0E-10
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 172 338 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0140657 ATP-dependent activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup12
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7861
Ophiocordyceps australis 1348a (Ghana) OphauG2|6896
Ophiocordyceps australis 1348a (Ghana) OphauG2|6506
Ophiocordyceps australis 1348a (Ghana) OphauG2|3168
Ophiocordyceps australis 1348a (Ghana) OphauG2|20
Ophiocordyceps australis map64 (Brazil) OphauB2|5123
Ophiocordyceps australis map64 (Brazil) OphauB2|2680
Ophiocordyceps australis map64 (Brazil) OphauB2|2813
Ophiocordyceps australis map64 (Brazil) OphauB2|2015
Ophiocordyceps australis map64 (Brazil) OphauB2|2149
Ophiocordyceps camponoti-floridani Ophcf2|01559
Ophiocordyceps camponoti-floridani Ophcf2|06888
Ophiocordyceps camponoti-floridani Ophcf2|06302
Ophiocordyceps camponoti-floridani Ophcf2|00261
Ophiocordyceps camponoti-floridani Ophcf2|05778
Ophiocordyceps camponoti-rufipedis Ophun1|1146 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|308
Ophiocordyceps camponoti-rufipedis Ophun1|5443
Ophiocordyceps camponoti-rufipedis Ophun1|6690
Ophiocordyceps camponoti-rufipedis Ophun1|6277
Ophiocordyceps kimflemingae Ophio5|3066
Ophiocordyceps kimflemingae Ophio5|4511
Ophiocordyceps kimflemingae Ophio5|5562
Ophiocordyceps kimflemingae Ophio5|6072
Ophiocordyceps kimflemingae Ophio5|7318
Ophiocordyceps subramaniannii Hirsu2|9346
Ophiocordyceps subramaniannii Hirsu2|8271
Ophiocordyceps subramaniannii Hirsu2|11264
Ophiocordyceps subramaniannii Hirsu2|10215
Ophiocordyceps subramaniannii Hirsu2|10021

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1146
MDETVVSARLLGMGETHSAGLVASLLVTRASSLAPKFSNDGFVDSDPPGTLLPLRGVWLHAYRKSWKLSLAGTQM
DPAGGKRANPEDEDVSRKKTKMGTTSGRQANPYLAHMYSGDDEGYDQGFGLGGFRRHETTASQAAKAEDGANNPY
TGRQHTQQYFRILETRRNLPVHKQRQEFLDKYHSTQILVFIGETGSGKTTQIPQYVVFDEIPQRTGKLIACTQPR
RVAAMSVAQRVADEMDVTLGEEVGYSIRFEDKTGPKTILKYMTDGMLLREAMHDHDMSRYTCIILDEAHERTLST
DILMALLKQLSMRRPDLKIIIMSATLDAQKFQKYFNDAPLLAVPGRTHPVEIFYTPEPERDYVEAAIRTVLQIHA
SEPEGDILLFLTGEDEIEDACRKIKLESDEMTREVDAGPLVVYPLYGTLPPQQQQRIFDKAPGAARSGGRPGRKC
IVSTNIAETSLTIDGIVYVVDPGFSKQKIYNPRIRVESLLVSPISKASAQQRAGRAGRTKPGKCFRLYTEKAFKK
ELIEQTHPEILRSNLANTVLELKKLGVEDLVHFDLMDPPAPETMMRALEELNYLACLDDDGELTALGSLASEFPL
DPALAVMLISSPEFYCSNEMLSITSLLSVPQIFLRPATSRTRADQMKAHFSHPDGDHLTLLNAYHAFKGQQATTM
DGGKQWCHEHFLSFRHLTSADNVRVQLKRIMETHEIELVSTPFEDKSYYTNIRRALLAGFFMQVAMKESSGKVYR
TVKDDQAVVIHPSTVLRTEFDWVVYHEFVLTSKQYIRTCTGIRPEWLLEIAPVYYDLDTFEDSEVLRSLKRATIK
KKRKEAMKAGR*
Coding >Ophun1|1146
ATGGACGAGACCGTGGTGTCTGCGAGACTGCTAGGGATGGGAGAGACCCACTCTGCCGGTCTCGTTGCCTCGTTA
CTCGTTACTCGTGCATCATCGTTGGCGCCGAAATTTTCCAACGACGGTTTCGTGGACTCTGACCCGCCTGGCACG
CTTCTGCCCCTGCGTGGCGTCTGGCTTCACGCGTACCGCAAATCTTGGAAGCTCTCTCTGGCTGGCACGCAGATG
GACCCGGCTGGCGGAAAGCGTGCAAACCCCGAAGACGAAGACGTTTCCAGGAAGAAGACGAAAATGGGGACGACA
TCGGGACGCCAGGCGAACCCTTACCTCGCCCACATGTACAGCGGCGATGATGAGGGCTATGATCAAGGCTTCGGT
CTCGGCGGCTTCCGGCGTCACGAGACAACGGCCAGCCAGGCAGCCAAGGCAGAAGACGGGGCCAACAACCCATAC
ACTGGGCGACAACATACGCAGCAGTATTTCCGAATCCTCGAGACGCGCCGAAATCTCCCGGTACATAAACAGAGA
CAAGAGTTTCTCGACAAATACCACTCGACACAGATCCTCGTCTTCATCGGTGAGACGGGTTCTGGAAAGACGACG
CAGATCCCGCAATACGTCGTCTTCGATGAAATCCCGCAGCGAACGGGCAAGCTCATCGCCTGCACGCAGCCGCGC
CGAGTGGCAGCCATGTCGGTGGCGCAGCGCGTTGCCGACGAGATGGACGTGACGCTCGGAGAAGAGGTCGGCTAC
AGCATTCGATTCGAAGACAAGACGGGGCCCAAGACGATTCTCAAGTACATGACGGACGGCATGCTTCTGCGCGAA
GCCATGCATGATCACGACATGTCCCGTTACACCTGCATCATCCTCGACGAGGCTCACGAGCGAACGCTATCGACG
GATATCCTTATGGCCCTGCTTAAGCAGTTGTCTATGCGGCGGCCCGATCTCAAGATCATCATCATGTCGGCCACG
CTCGACGCGCAGAAATTTCAAAAGTACTTTAACGATGCGCCCCTACTGGCGGTCCCTGGCCGCACGCACCCGGTA
GAGATCTTCTACACGCCGGAACCGGAGAGAGACTACGTCGAGGCGGCGATCCGGACGGTGCTGCAGATCCACGCG
TCGGAGCCCGAGGGCGACATCCTGCTATTCCTGACGGGCGAAGACGAGATCGAGGATGCGTGTCGCAAGATCAAG
CTCGAGTCGGACGAGATGACGCGAGAGGTGGACGCTGGCCCGCTGGTCGTGTATCCGCTCTACGGCACTCTGCCG
CCTCAGCAGCAGCAGCGCATCTTCGACAAGGCTCCTGGAGCGGCTCGCAGTGGAGGGCGTCCCGGGCGCAAGTGT
ATCGTGTCGACCAATATCGCGGAGACGAGTTTGACGATCGACGGCATCGTCTACGTGGTGGACCCCGGGTTCAGC
AAGCAAAAGATCTACAATCCCCGGATCCGAGTCGAGTCGCTGCTCGTGTCGCCCATCTCCAAGGCGTCGGCGCAG
CAGCGGGCCGGTCGTGCTGGGCGAACCAAGCCCGGTAAATGCTTCCGGCTGTACACGGAGAAGGCATTCAAGAAG
GAGTTGATTGAGCAGACGCACCCCGAGATCCTGCGATCCAACCTGGCCAACACGGTGCTGGAGCTGAAGAAGCTC
GGCGTCGAGGATCTGGTGCACTTTGACCTGATGGACCCGCCGGCGCCCGAGACGATGATGCGAGCGCTCGAGGAG
CTCAACTATCTGGCCTGCCTGGACGACGACGGCGAGCTGACGGCGCTGGGGAGTCTGGCATCCGAGTTTCCGCTG
GACCCGGCGCTGGCGGTGATGCTCATCTCGTCTCCCGAGTTCTACTGCTCCAACGAGATGCTGTCCATCACGTCA
CTTCTGTCGGTGCCGCAGATCTTCTTGCGACCGGCCACCAGTCGGACGCGAGCCGACCAGATGAAGGCGCACTTT
AGCCACCCAGACGGCGATCACCTGACGCTTCTCAACGCCTATCACGCCTTCAAGGGCCAGCAGGCGACGACAATG
GACGGCGGGAAGCAGTGGTGTCACGAGCACTTCCTGTCCTTTAGGCACCTGACGAGCGCAGACAACGTGCGGGTA
CAGCTCAAGCGCATCATGGAGACGCACGAGATCGAGCTGGTATCGACGCCCTTTGAGGACAAGAGCTACTACACC
AACATCCGTCGCGCCCTTCTCGCCGGCTTCTTCATGCAGGTGGCCATGAAGGAGAGCTCGGGCAAGGTGTACAGG
ACGGTCAAGGACGACCAGGCGGTGGTGATCCATCCGTCGACGGTGCTGCGGACCGAGTTCGACTGGGTCGTGTAT
CACGAGTTTGTCCTCACGTCGAAGCAGTACATCCGGACGTGCACCGGCATCCGGCCCGAGTGGCTACTGGAAATC
GCTCCGGTCTACTACGATCTCGATACGTTTGAGGATAGCGAGGTGCTGCGGTCTCTGAAGAGGGCGACTATCAAG
AAGAAACGCAAGGAGGCGATGAAGGCTGGGCGATAG
Transcript >Ophun1|1146
ATGGACGAGACCGTGGTGTCTGCGAGACTGCTAGGGATGGGAGAGACCCACTCTGCCGGTCTCGTTGCCTCGTTA
CTCGTTACTCGTGCATCATCGTTGGCGCCGAAATTTTCCAACGACGGTTTCGTGGACTCTGACCCGCCTGGCACG
CTTCTGCCCCTGCGTGGCGTCTGGCTTCACGCGTACCGCAAATCTTGGAAGCTCTCTCTGGCTGGCACGCAGATG
GACCCGGCTGGCGGAAAGCGTGCAAACCCCGAAGACGAAGACGTTTCCAGGAAGAAGACGAAAATGGGGACGACA
TCGGGACGCCAGGCGAACCCTTACCTCGCCCACATGTACAGCGGCGATGATGAGGGCTATGATCAAGGCTTCGGT
CTCGGCGGCTTCCGGCGTCACGAGACAACGGCCAGCCAGGCAGCCAAGGCAGAAGACGGGGCCAACAACCCATAC
ACTGGGCGACAACATACGCAGCAGTATTTCCGAATCCTCGAGACGCGCCGAAATCTCCCGGTACATAAACAGAGA
CAAGAGTTTCTCGACAAATACCACTCGACACAGATCCTCGTCTTCATCGGTGAGACGGGTTCTGGAAAGACGACG
CAGATCCCGCAATACGTCGTCTTCGATGAAATCCCGCAGCGAACGGGCAAGCTCATCGCCTGCACGCAGCCGCGC
CGAGTGGCAGCCATGTCGGTGGCGCAGCGCGTTGCCGACGAGATGGACGTGACGCTCGGAGAAGAGGTCGGCTAC
AGCATTCGATTCGAAGACAAGACGGGGCCCAAGACGATTCTCAAGTACATGACGGACGGCATGCTTCTGCGCGAA
GCCATGCATGATCACGACATGTCCCGTTACACCTGCATCATCCTCGACGAGGCTCACGAGCGAACGCTATCGACG
GATATCCTTATGGCCCTGCTTAAGCAGTTGTCTATGCGGCGGCCCGATCTCAAGATCATCATCATGTCGGCCACG
CTCGACGCGCAGAAATTTCAAAAGTACTTTAACGATGCGCCCCTACTGGCGGTCCCTGGCCGCACGCACCCGGTA
GAGATCTTCTACACGCCGGAACCGGAGAGAGACTACGTCGAGGCGGCGATCCGGACGGTGCTGCAGATCCACGCG
TCGGAGCCCGAGGGCGACATCCTGCTATTCCTGACGGGCGAAGACGAGATCGAGGATGCGTGTCGCAAGATCAAG
CTCGAGTCGGACGAGATGACGCGAGAGGTGGACGCTGGCCCGCTGGTCGTGTATCCGCTCTACGGCACTCTGCCG
CCTCAGCAGCAGCAGCGCATCTTCGACAAGGCTCCTGGAGCGGCTCGCAGTGGAGGGCGTCCCGGGCGCAAGTGT
ATCGTGTCGACCAATATCGCGGAGACGAGTTTGACGATCGACGGCATCGTCTACGTGGTGGACCCCGGGTTCAGC
AAGCAAAAGATCTACAATCCCCGGATCCGAGTCGAGTCGCTGCTCGTGTCGCCCATCTCCAAGGCGTCGGCGCAG
CAGCGGGCCGGTCGTGCTGGGCGAACCAAGCCCGGTAAATGCTTCCGGCTGTACACGGAGAAGGCATTCAAGAAG
GAGTTGATTGAGCAGACGCACCCCGAGATCCTGCGATCCAACCTGGCCAACACGGTGCTGGAGCTGAAGAAGCTC
GGCGTCGAGGATCTGGTGCACTTTGACCTGATGGACCCGCCGGCGCCCGAGACGATGATGCGAGCGCTCGAGGAG
CTCAACTATCTGGCCTGCCTGGACGACGACGGCGAGCTGACGGCGCTGGGGAGTCTGGCATCCGAGTTTCCGCTG
GACCCGGCGCTGGCGGTGATGCTCATCTCGTCTCCCGAGTTCTACTGCTCCAACGAGATGCTGTCCATCACGTCA
CTTCTGTCGGTGCCGCAGATCTTCTTGCGACCGGCCACCAGTCGGACGCGAGCCGACCAGATGAAGGCGCACTTT
AGCCACCCAGACGGCGATCACCTGACGCTTCTCAACGCCTATCACGCCTTCAAGGGCCAGCAGGCGACGACAATG
GACGGCGGGAAGCAGTGGTGTCACGAGCACTTCCTGTCCTTTAGGCACCTGACGAGCGCAGACAACGTGCGGGTA
CAGCTCAAGCGCATCATGGAGACGCACGAGATCGAGCTGGTATCGACGCCCTTTGAGGACAAGAGCTACTACACC
AACATCCGTCGCGCCCTTCTCGCCGGCTTCTTCATGCAGGTGGCCATGAAGGAGAGCTCGGGCAAGGTGTACAGG
ACGGTCAAGGACGACCAGGCGGTGGTGATCCATCCGTCGACGGTGCTGCGGACCGAGTTCGACTGGGTCGTGTAT
CACGAGTTTGTCCTCACGTCGAAGCAGTACATCCGGACGTGCACCGGCATCCGGCCCGAGTGGCTACTGGAAATC
GCTCCGGTCTACTACGATCTCGATACGTTTGAGGATAGCGAGGTGCTGCGGTCTCTGAAGAGGGCGACTATCAAG
AAGAAACGCAAGGAGGCGATGAAGGCTGGGCGATAG
Gene >Ophun1|1146
ATGGACGAGACCGTGGTGTCTGCGAGACTGCTAGGGATGGGAGAGGTGAGTATGTGCGAAGTATGATTGACACGG
TATTTAAGATCTGACTGTGAGTCTGTGAGAAGAGACGGCCAAGATGTGAGGGCAGAGAATGATGCCCATGGCTGA
GATTTCTGAGCGGGTGGGAATTGCTTGAATTTGGAAGGCCTCTGGCAGTGGCAGTACCTAAGATACAGTGTGCGC
CACACCCAGCGGTAAAAGTGCGGCATCCGCGTGGGTATGCAAGTCTTCTGCTGAGCCACGCAAATGAGGTGCTGG
GAGCCACCTGCTAGAGCTCTCGAATTTGGTCGAAGCAGCTTCCGTCATATTCCTCATACATCAAAGCTCCGGCTC
GTGGCGTTCGGCAGGAGGACCAGCAGTCTGTGCGCGGCACACTGTGTAGGCTGTAGCAGGGTCCTTATCGGCACC
GAATCTGTATCGATAGGGTTATCGGGGAACGGATATCGATAGACCCACTCTGCCGGTCTCGTTGCCTCGTTACTC
GTTACTCGTGCATCATCGTTGGCGCCGAAATTTTCCAACGACGGTTTCGTGGACTCTGACCCGCCTGGCACGCTT
CTGCCCCTGCGTGGCGTCTGGCTTCACGCGTACCGCAAATCTTGGAAGCTCTCTCTGGCTGGCACGCAGATGGAC
CCGGCTGGCGGAAAGCGTGCAAACCCCGAAGACGAAGACGTTTCCAGGAAGAAGACGAAAATGGGGACGACATCG
GGACGCCAGGCGAACCCTTACCTCGCCCACATGTACAGCGGCGATGATGAGGGCTATGATCAAGGCTTCGGTCTC
GGCGGCTTCCGGCGTCACGAGACAACGGCCAGCCAGGCAGCCAAGGCAGAAGACGGGGCCAACAACCCATACACT
GGGCGACAACATACGCAGCAGTATTTCCGAATCCTCGAGACGCGCCGAAATCTCCCGGTACATAAACAGAGGTCA
GGAAAGAGACGATGTCGCGAGAGTGGCTGGATATGCTGACGCGAGAGGCAGACAAGAGTTTCTCGACAAATACCA
CTCGACACAGATCCTCGTCTTCATCGGTGAGACGGGTTCTGGAAAGACGACGCAGATCCCGCAATACGTCGTCTT
CGATGAAATCCCGCAGCGAACGGGCAAGCTCATCGCCTGCACGCAGCCGCGCCGAGTGGCAGCCATGTCGGTGGC
GCAGCGCGTTGCCGACGAGATGGACGTGACGCTCGGAGAAGAGGTCGGCTACAGCATTCGATTCGAAGACAAGAC
GGGGCCCAAGACGATTCTCAAGTACATGACGGACGGCATGCTTCTGCGCGAAGCCATGCATGATCACGACATGTC
CCGTTACACCTGCATCATCCTCGACGAGGCTCACGAGCGAACGCTATCGACGGATATCCTTATGGCCCTGCTTAA
GCAGTTGTCTATGCGGCGGCCCGATCTCAAGATCATCATCATGTCGGCCACGCTCGACGCGCAGAAATTTCAAAA
GTACTTTAACGATGCGCCCCTACTGGCGGTCCCTGGCCGCACGCACCCGGTAGAGATCTTCTACACGCCGGAACC
GGAGAGAGACTACGTCGAGGCGGCGATCCGGACGGTGCTGCAGATCCACGCGTCGGAGCCCGAGGGCGACATCCT
GCTATTCCTGACGGGCGAAGACGAGATCGAGGATGCGTGTCGCAAGATCAAGCTCGAGTCGGACGAGATGACGCG
AGAGGTGGACGCTGGCCCGCTGGTCGTGTATCCGCTCTACGGCACTCTGCCGCCTCAGCAGCAGCAGCGCATCTT
CGACAAGGCTCCTGGAGCGGCTCGCAGTGGAGGGCGTCCCGGGCGCAAGTGTATCGTGTCGACCAATATCGCGGA
GACGAGTTTGACGATCGACGGCATCGTCTACGTGGTGGACCCCGGGTTCAGCAAGCAAAAGATCTACAATCCCCG
GATCCGAGTCGAGTCGCTGCTCGTGTCGCCCATCTCCAAGGCGTCGGCGCAGCAGCGGGCCGGTCGTGCTGGGCG
AACCAAGCCCGGTAAATGCTTCCGGCTGTACACGGAGAAGGCATTCAAGAAGGAGTTGATTGAGCAGACGCACCC
CGAGATCCTGCGATCCAACCTGGCCAACACGGTGCTGGAGCTGAAGAAGCTCGGCGTCGAGGATCTGGTGCACTT
TGACCTGATGGACCCGCCGGCGCCCGAGACGATGATGCGAGCGCTCGAGGAGCTCAACTATCTGGCCTGCCTGGA
CGACGACGGCGAGCTGACGGCGCTGGGGAGTCTGGCATCCGAGTTTCCGCTGGACCCGGCGCTGGCGGTGATGCT
CATCTCGTCTCCCGAGTTCTACTGCTCCAACGAGATGCTGTCCATCACGTCACTTCTGTCGGTGCCGCAGATCTT
CTTGCGACCGGCCACCAGTCGGACGCGAGCCGACCAGATGAAGGCGCACTTTAGCCACCCAGACGGCGATCACCT
GACGCTTCTCAACGCCTATCACGCCTTCAAGGGCCAGCAGGCGACGACAATGGACGGCGGGAAGCAGTGGTGTCA
CGAGCACTTCCTGTCCTTTAGGCACCTGACGAGCGCAGACAACGTGCGGGTACAGCTCAAGCGCATCATGGAGAC
GCACGAGATCGAGCTGGTATCGACGCCCTTTGAGGACAAGAGCTACTACACCAACATCCGTCGCGCCCTTCTCGC
CGGCTTCTTCATGCAGGTGGCCATGAAGGAGAGCTCGGGCAAGGTGTACAGGACGGTCAAGGACGACCAGGCGGT
GGTGATCCATCCGTCGACGGTGCTGCGGACCGAGTTCGACTGGGTCGTGTATCACGAGTTTGTCCTCACGTCGAA
GCAGTACATCCGGACGTGCACCGGCATCCGGCCCGAGTGGCTACTGGTGAGTTGTGCCATGTCCGTGTTGGGCCC
CTGGGCTGTACTGACTGGGCTCGTGTGACAGGAAATCGCTCCGGTCTACTACGATCTCGATACGTTTGAGGATAG
CGAGGTGCTGCGGTCTCTGAAGAGGGCGACTATCAAGAAGAAACGCAAGGAGGCGATGAAGGCTGGGCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail