Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1145
Gene name
LocationContig_143:14359..16913
Strand-
Gene length (bp)2554
Transcript length (bp)2370
Coding sequence length (bp)2370
Protein length (aa) 790

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17285 PRMT5_TIM PRMT5 TIM barrel domain 1.0E-65 47 369
PF05185 PRMT5 PRMT5 arginine-N-methyltransferase 2.1E-65 385 564
PF17286 PRMT5_C PRMT5 oligomerisation domain 7.7E-54 567 789

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78963|SKB1_SCHPO Protein arginine N-methyltransferase skb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skb1 PE=1 SV=2 44 789 2.0E-128
sp|Q6NUA1|ANM5_XENLA Protein arginine N-methyltransferase 5 OS=Xenopus laevis GN=prmt5 PE=1 SV=1 25 760 4.0E-99
sp|Q5R698|ANM5_PONAB Protein arginine N-methyltransferase 5 OS=Pongo abelii GN=PRMT5 PE=2 SV=3 29 762 2.0E-98
sp|O14744|ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 29 762 6.0E-98
sp|Q8CIG8|ANM5_MOUSE Protein arginine N-methyltransferase 5 OS=Mus musculus GN=Prmt5 PE=1 SV=3 29 762 2.0E-97
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78963|SKB1_SCHPO Protein arginine N-methyltransferase skb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skb1 PE=1 SV=2 44 789 2.0E-128
sp|Q6NUA1|ANM5_XENLA Protein arginine N-methyltransferase 5 OS=Xenopus laevis GN=prmt5 PE=1 SV=1 25 760 4.0E-99
sp|Q5R698|ANM5_PONAB Protein arginine N-methyltransferase 5 OS=Pongo abelii GN=PRMT5 PE=2 SV=3 29 762 2.0E-98
sp|O14744|ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 29 762 6.0E-98
sp|Q8CIG8|ANM5_MOUSE Protein arginine N-methyltransferase 5 OS=Mus musculus GN=Prmt5 PE=1 SV=3 29 762 2.0E-97
sp|Q4R5M3|ANM5_MACFA Protein arginine N-methyltransferase 5 OS=Macaca fascicularis GN=PRMT5 PE=2 SV=3 29 762 7.0E-97
sp|A7YW45|ANM5_BOVIN Protein arginine N-methyltransferase 5 OS=Bos taurus GN=PRMT5 PE=2 SV=1 29 762 2.0E-96
sp|Q6YXZ7|ANM5_ORYSJ Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. japonica GN=PRMT5 PE=2 SV=1 97 762 2.0E-94
sp|A2X0Q3|ANM5_ORYSI Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. indica GN=PRMT5 PE=3 SV=2 97 762 4.0E-94
sp|Q8GWT4|ANM15_ARATH Protein arginine N-methyltransferase 1.5 OS=Arabidopsis thaliana GN=PMRT15 PE=1 SV=2 42 762 4.0E-89
sp|Q54KI3|ANM5_DICDI Protein arginine N-methyltransferase 5 OS=Dictyostelium discoideum GN=prmt5 PE=3 SV=1 122 758 4.0E-78
sp|P38274|HSL7_YEAST Protein arginine N-methyltransferase HSL7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL7 PE=1 SV=1 50 782 9.0E-75
sp|Q9U6Y9|ANM5_DROME Protein arginine N-methyltransferase 5 OS=Drosophila melanogaster GN=csul PE=1 SV=2 230 760 3.0E-56
sp|P46580|ANM5_CAEEL Protein arginine N-methyltransferase 5 OS=Caenorhabditis elegans GN=prmt-5 PE=1 SV=2 118 761 4.0E-55
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4094
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|19
Ophiocordyceps australis map64 (Brazil) OphauB2|2679
Ophiocordyceps camponoti-floridani Ophcf2|05779
Ophiocordyceps camponoti-rufipedis Ophun1|1145 (this protein)
Ophiocordyceps kimflemingae Ophio5|3065
Ophiocordyceps subramaniannii Hirsu2|8270

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1145
MDSVSVSPPVESSDCGSQRPPFHIGNHDSNRDVPLSDRQYGHLLNQGISFVTTPITNGHFKARIFKLVSDYLTLL
DRNGETATSNSSSARADPILPPLTPDDTGLFPSDAVTTYTAFVSPWIDLCSSNPVIASVSRQVLNLEINYANFCG
VRSIVITGPHRDACNGGSQGLVQFSRAVHEALTIGNCLSFLIHMPMYREAEVTAQAETLSSLRPQKLSDEKKVID
VFSCWDSWHQVRTVCRYNARLFLALKLPRFIPEKELQSRWFAEPIHFLTMGPEVFQTNKSGYPCFSKHHQEMIFA
HMRLKAMPSLLLCDVGPDASRIKPHWPSSLDNPPPVTDEEFPTLTAARETDEMTDENHSYANANIAYLQWLQSQQ
PPLPALESTTLTSFQDWLQSPLQPLSDNLESATYEVFEGDPVKYKRYEEAIIQALEDWRDFALPTSKKGVVVVAV
AGSGRGPLVSRALSAAQATGVDIEVWAVEKNPNAYVYLLRQNQTQWGGGVNVVKTDMRAWKGPIVSEGSDTGPVY
GKVDILISELLGSFGDNELSPECLDGIQHVLAKPHGISIPNSYTAHLSPISDPKVYAEILARSALDTTAFDTPWV
VRLYALDFVCQRVPDHPRIQQAWEFSHPISDSALQAIQARRSGGVVGGGGGSMAGAAGANDHNSRFCHLKFVCRC
PGVIHGLAGYFESTLYKSKHENRMGEKVEISTHPERIDSKSRDMASWFPIFFPLREPLTYPYDSELEVSMWRQTD
DTRVWYEWLVEAWTWTSPTLRIKMATSALCSSRKVACLM*
Coding >Ophun1|1145
ATGGATTCCGTCAGCGTCTCTCCGCCCGTCGAGAGCTCAGACTGTGGCTCTCAGAGGCCCCCTTTTCACATCGGT
AATCACGACTCGAACCGAGACGTTCCCCTCAGTGACCGGCAATACGGCCATCTATTGAACCAGGGTATCAGCTTT
GTCACCACGCCTATAACCAACGGCCACTTCAAAGCTAGAATCTTCAAGCTCGTCTCGGACTACCTGACGTTGCTG
GACCGTAACGGCGAGACTGCAACAAGCAACTCCTCCTCTGCTCGGGCTGATCCCATCTTGCCACCTCTGACACCC
GACGATACTGGTCTATTCCCATCTGATGCCGTCACCACTTACACGGCCTTTGTCAGCCCATGGATCGACCTCTGT
TCTTCGAACCCCGTCATCGCCAGCGTCTCCCGCCAGGTCTTGAACCTCGAGATCAATTATGCCAACTTTTGCGGT
GTCAGGAGCATCGTCATTACCGGGCCGCATCGCGATGCATGCAACGGCGGCAGCCAAGGCCTGGTTCAGTTTTCC
CGTGCCGTTCATGAAGCCCTGACCATTGGCAATTGCTTGTCCTTTCTGATTCACATGCCCATGTATCGGGAGGCC
GAAGTAACCGCTCAGGCCGAGACGTTGTCGTCGCTCAGGCCTCAGAAGCTCTCAGACGAGAAGAAAGTGATTGAT
GTTTTCAGCTGCTGGGACTCTTGGCACCAGGTTCGAACGGTGTGTCGCTACAATGCGAGGCTCTTCCTCGCCCTC
AAGTTGCCCAGATTTATACCGGAAAAGGAGCTTCAGAGTCGCTGGTTTGCGGAGCCTATTCACTTCTTGACCATG
GGGCCAGAGGTTTTCCAGACCAATAAGAGCGGCTATCCCTGCTTCTCAAAACATCATCAGGAGATGATATTCGCC
CACATGCGCCTCAAAGCTATGCCCTCGCTGCTCCTGTGTGACGTCGGCCCCGATGCCTCCCGAATCAAGCCACAT
TGGCCTTCGTCGCTGGACAATCCTCCGCCAGTAACCGACGAAGAATTCCCAACCTTGACCGCGGCCCGCGAGACG
GATGAAATGACTGATGAGAATCACTCTTACGCAAACGCCAATATCGCGTACCTGCAGTGGCTTCAATCGCAGCAG
CCACCTCTTCCAGCCCTCGAATCGACGACTCTCACGAGCTTTCAAGACTGGCTGCAGTCGCCGCTCCAACCGCTA
TCGGACAACCTGGAATCGGCCACGTACGAGGTATTTGAAGGCGACCCGGTCAAGTACAAACGATACGAAGAGGCA
ATCATACAAGCCTTGGAGGATTGGAGAGATTTCGCACTGCCGACGTCCAAGAAGGGCGTTGTCGTTGTGGCCGTC
GCCGGTTCCGGGCGCGGTCCTCTTGTCAGTCGAGCCCTATCCGCAGCTCAGGCGACGGGCGTCGACATTGAGGTC
TGGGCGGTGGAGAAGAACCCCAATGCCTACGTATATCTGTTGCGCCAAAACCAAACGCAATGGGGCGGAGGTGTC
AATGTGGTCAAGACAGACATGCGGGCCTGGAAAGGGCCCATCGTGAGCGAGGGATCGGACACAGGTCCAGTCTAC
GGCAAGGTGGATATCTTGATCTCCGAGCTCCTCGGCTCTTTCGGCGACAACGAGCTGTCTCCCGAATGTCTGGAC
GGCATCCAGCATGTGCTGGCGAAGCCGCACGGCATCTCGATCCCCAACTCCTATACGGCTCACCTCAGTCCCATC
TCAGACCCCAAGGTCTATGCGGAAATTCTCGCGAGATCGGCCTTGGACACGACGGCCTTTGACACGCCCTGGGTG
GTGAGGCTCTACGCGCTCGATTTTGTCTGCCAACGTGTGCCGGATCACCCTCGAATCCAGCAGGCCTGGGAATTC
TCTCACCCGATCTCGGACTCGGCACTGCAGGCGATACAAGCCAGACGTTCCGGGGGCGTCGTCGGCGGTGGTGGT
GGGAGCATGGCCGGCGCGGCTGGCGCCAACGATCACAACTCACGATTTTGCCACCTCAAGTTTGTATGCCGCTGC
CCCGGCGTTATTCACGGGCTGGCGGGATACTTTGAGTCGACTCTCTACAAGTCGAAACATGAGAACAGGATGGGC
GAAAAGGTGGAAATCAGCACACACCCGGAGAGGATCGACAGCAAGAGCAGAGATATGGCCTCTTGGTTCCCAATA
TTCTTTCCTCTCAGGGAGCCTTTGACGTATCCGTACGACTCAGAACTCGAGGTGAGCATGTGGCGCCAGACGGAC
GACACACGCGTATGGTACGAGTGGCTGGTGGAGGCTTGGACGTGGACAAGCCCAACCCTGCGCATCAAGATGGCG
ACATCGGCCCTCTGCAGCAGCCGAAAGGTGGCCTGTCTGATGTAG
Transcript >Ophun1|1145
ATGGATTCCGTCAGCGTCTCTCCGCCCGTCGAGAGCTCAGACTGTGGCTCTCAGAGGCCCCCTTTTCACATCGGT
AATCACGACTCGAACCGAGACGTTCCCCTCAGTGACCGGCAATACGGCCATCTATTGAACCAGGGTATCAGCTTT
GTCACCACGCCTATAACCAACGGCCACTTCAAAGCTAGAATCTTCAAGCTCGTCTCGGACTACCTGACGTTGCTG
GACCGTAACGGCGAGACTGCAACAAGCAACTCCTCCTCTGCTCGGGCTGATCCCATCTTGCCACCTCTGACACCC
GACGATACTGGTCTATTCCCATCTGATGCCGTCACCACTTACACGGCCTTTGTCAGCCCATGGATCGACCTCTGT
TCTTCGAACCCCGTCATCGCCAGCGTCTCCCGCCAGGTCTTGAACCTCGAGATCAATTATGCCAACTTTTGCGGT
GTCAGGAGCATCGTCATTACCGGGCCGCATCGCGATGCATGCAACGGCGGCAGCCAAGGCCTGGTTCAGTTTTCC
CGTGCCGTTCATGAAGCCCTGACCATTGGCAATTGCTTGTCCTTTCTGATTCACATGCCCATGTATCGGGAGGCC
GAAGTAACCGCTCAGGCCGAGACGTTGTCGTCGCTCAGGCCTCAGAAGCTCTCAGACGAGAAGAAAGTGATTGAT
GTTTTCAGCTGCTGGGACTCTTGGCACCAGGTTCGAACGGTGTGTCGCTACAATGCGAGGCTCTTCCTCGCCCTC
AAGTTGCCCAGATTTATACCGGAAAAGGAGCTTCAGAGTCGCTGGTTTGCGGAGCCTATTCACTTCTTGACCATG
GGGCCAGAGGTTTTCCAGACCAATAAGAGCGGCTATCCCTGCTTCTCAAAACATCATCAGGAGATGATATTCGCC
CACATGCGCCTCAAAGCTATGCCCTCGCTGCTCCTGTGTGACGTCGGCCCCGATGCCTCCCGAATCAAGCCACAT
TGGCCTTCGTCGCTGGACAATCCTCCGCCAGTAACCGACGAAGAATTCCCAACCTTGACCGCGGCCCGCGAGACG
GATGAAATGACTGATGAGAATCACTCTTACGCAAACGCCAATATCGCGTACCTGCAGTGGCTTCAATCGCAGCAG
CCACCTCTTCCAGCCCTCGAATCGACGACTCTCACGAGCTTTCAAGACTGGCTGCAGTCGCCGCTCCAACCGCTA
TCGGACAACCTGGAATCGGCCACGTACGAGGTATTTGAAGGCGACCCGGTCAAGTACAAACGATACGAAGAGGCA
ATCATACAAGCCTTGGAGGATTGGAGAGATTTCGCACTGCCGACGTCCAAGAAGGGCGTTGTCGTTGTGGCCGTC
GCCGGTTCCGGGCGCGGTCCTCTTGTCAGTCGAGCCCTATCCGCAGCTCAGGCGACGGGCGTCGACATTGAGGTC
TGGGCGGTGGAGAAGAACCCCAATGCCTACGTATATCTGTTGCGCCAAAACCAAACGCAATGGGGCGGAGGTGTC
AATGTGGTCAAGACAGACATGCGGGCCTGGAAAGGGCCCATCGTGAGCGAGGGATCGGACACAGGTCCAGTCTAC
GGCAAGGTGGATATCTTGATCTCCGAGCTCCTCGGCTCTTTCGGCGACAACGAGCTGTCTCCCGAATGTCTGGAC
GGCATCCAGCATGTGCTGGCGAAGCCGCACGGCATCTCGATCCCCAACTCCTATACGGCTCACCTCAGTCCCATC
TCAGACCCCAAGGTCTATGCGGAAATTCTCGCGAGATCGGCCTTGGACACGACGGCCTTTGACACGCCCTGGGTG
GTGAGGCTCTACGCGCTCGATTTTGTCTGCCAACGTGTGCCGGATCACCCTCGAATCCAGCAGGCCTGGGAATTC
TCTCACCCGATCTCGGACTCGGCACTGCAGGCGATACAAGCCAGACGTTCCGGGGGCGTCGTCGGCGGTGGTGGT
GGGAGCATGGCCGGCGCGGCTGGCGCCAACGATCACAACTCACGATTTTGCCACCTCAAGTTTGTATGCCGCTGC
CCCGGCGTTATTCACGGGCTGGCGGGATACTTTGAGTCGACTCTCTACAAGTCGAAACATGAGAACAGGATGGGC
GAAAAGGTGGAAATCAGCACACACCCGGAGAGGATCGACAGCAAGAGCAGAGATATGGCCTCTTGGTTCCCAATA
TTCTTTCCTCTCAGGGAGCCTTTGACGTATCCGTACGACTCAGAACTCGAGGTGAGCATGTGGCGCCAGACGGAC
GACACACGCGTATGGTACGAGTGGCTGGTGGAGGCTTGGACGTGGACAAGCCCAACCCTGCGCATCAAGATGGCG
ACATCGGCCCTCTGCAGCAGCCGAAAGGTGGCCTGTCTGATGTAG
Gene >Ophun1|1145
ATGGATTCCGTCAGCGTCTCTCCGCCCGTCGAGAGCTCAGACTGTGGCTCTCAGAGGCCCCCTTTTCACATCGGT
AATCACGACTCGAACCGAGACGTTCCCCTCAGTGACCGGCAATACGGCCATCTATTGAACCAGGGTGTAAGTGGC
CGGAGAGGCCTTTTCGTCTTCTGATGCGCCGCGTCTGACTCGCCAGCAAGATCAGCTTTGTCACCACGCCTATAA
CCAACGGCCACTTCAAAGCTAGAATCTTCAAGCTCGTCTCGGACTACCTGACGTTGCTGGACCGTAACGGCGAGA
CTGCAACAAGCAACTCCTCCTCTGCTCGGGCTGATCCCATCTTGCCACCTCTGACACCCGACGATACTGGTCTAT
TCCCATCTGATGCCGTCACCACTTACACGGCCTTTGTCAGCCCATGGATCGACCTCTGTTCTTCGAACCCCGTCA
TCGCCAGCGTCTCCCGCCAGGTCTTGAACCTCGAGATCAATTATGCCAACTTTTGCGGTGTCAGGAGCATCGTCA
TTACCGGGCCGCATCGCGATGCATGCAACGGCGGCAGCCAAGGCCTGGTTCAGTTTTCCCGTGCCGTTCATGAAG
CCCTGACCATTGGCAATTGCTTGTCCTTTCTGATTCACATGCCCATGTATCGGGAGGCCGAAGTAACCGCTCAGG
CCGAGACGTTGTCGTCGCTCAGGCCTCAGAAGCTCTCAGACGAGAAGAAAGTGATTGATGTTTTCAGCTGCTGGG
ACTCTTGGCACCAGGTTCGAACGGTGTGTCGCTACAATGCGAGGCTCTTCCTCGGTGGGTGAAGATAACCTCTAG
ACATGTTTCATCACTGCTGACGACAGTCTCACCATCACCAGCCCTCAAGTTGCCCAGATTTATACCGGAAAAGGA
GCTTCAGAGTCGCTGGTTTGCGGAGCCTATTCACTTCTTGACCATGGGGCCAGAGGTTTTCCAGACCAATAAGAG
CGGCTATCCCTGCTTCTCAAAACATCATCAGGAGATGATATTCGCCCACATGCGCCTCAAAGCTATGCCCTCGCT
GCTCCTGTGTGACGTCGGCCCCGATGCCTCCCGAATCAAGCCACATTGGCCTTCGTCGCTGGACAATCCTCCGCC
AGTAACCGACGAAGAATTCCCAACCTTGACCGCGGCCCGCGAGACGGATGAAATGACTGATGAGAATCACTCTTA
CGCAAACGCCAATATCGCGTACCTGCAGTGGCTTCAATCGCAGCAGCCACCTCTTCCAGCCCTCGAATCGACGAC
TCTCACGAGCTTTCAAGACTGGCTGCAGTCGCCGCTCCAACCGCTATCGGACAACCTGGAATCGGCCACGTACGA
GGTATTTGAAGGCGACCCGGTCAAGTACAAACGATACGAAGAGGCAATCATACAAGCCTTGGAGGATTGGAGAGA
TTTCGCACTGCCGACGTCCAAGAAGGGCGTTGTCGTTGTGGCCGTCGCCGGTTCCGGGCGCGGTCCTCTTGTCAG
TCGAGCCCTATCCGCAGCTCAGGCGACGGGCGTCGACATTGAGGTCTGGGCGGTGGAGAAGAACCCCAATGCCTA
CGTATATCTGTTGCGCCAAAACCAAACGCAATGGGGCGGAGGTGTCAATGTGGTCAAGACAGACATGCGGGCCTG
GAAAGGGCCCATCGTGAGCGAGGGATCGGACACAGGTCCAGTCTACGGCAAGGTGGATATCTTGATCTCCGAGCT
CCTCGGCTCTTTCGGCGACAACGAGCTGTCTCCCGAATGTCTGGACGGCATCCAGCATGTGCTGGCGAAGCCGCA
CGGCATCTCGATCCCCAACTCCTATACGGCTCACCTCAGTCCCATCTCAGACCCCAAGGTCTATGCGGAAATTCT
CGCGAGATCGGCCTTGGACACGACGGCCTTTGACACGCCCTGGGTGGTGAGGCTCTACGCGCTCGATTTTGTCTG
CCAACGTGTGCCGGATCACCCTCGAATCCAGCAGGCCTGGGAATTCTCTCACCCGATCTCGGACTCGGCACTGCA
GGCGATACAAGCCAGACGTTCCGGGGGCGTCGTCGGCGGTGGTGGTGGGAGCATGGCCGGCGCGGCTGGCGCCAA
CGATCACAACTCACGATTTTGCCACCTCAAGTTTGTATGCCGCTGCCCCGGCGTTATTCACGGGCTGGCGGGATA
CTTTGAGTCGACTCTCTACAAGTCGAAACATGAGAACAGGATGGGCGAAAAGGTGGAAATCAGCACACACCCGGA
GAGGATCGACAGCAAGAGCAGAGATATGGCCTCTTGGTTCCCAATATTCTTTCCTCTCAGGGTGAGTCAAGGCTT
CGGGTATGCTATTTATGGCCATGAAAAAAACTGACTCTGTTATCTGCAGGAGCCTTTGACGTATCCGTACGACTC
AGAACTCGAGGTGAGCATGTGGCGCCAGACGGACGACACACGCGTATGGTACGAGTGGCTGGTGGAGGCTTGGAC
GTGGACAAGCCCAACCCTGCGCATCAAGATGGCGACATCGGCCCTCTGCAGCAGCCGAAAGGTGGCCTGTCTGAT
GTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail