Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1138
Gene name
LocationContig_143:26..666
Strand+
Gene length (bp)640
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10241 KxDL Uncharacterized conserved protein 6.3E-32 87 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CMK9|KXD1_KLULA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KXD1 PE=3 SV=1 79 178 1.0E-09
sp|C5E000|KXD1_ZYGRC Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=KXD1 PE=3 SV=1 53 179 4.0E-09
sp|Q755A2|KXD1_ASHGO Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KXD1 PE=3 SV=1 41 178 2.0E-08
sp|Q6FS55|KXD1_CANGA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KXD1 PE=3 SV=1 70 179 5.0E-08
sp|E7Q3U6|KXD1_YEASB Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain FostersB) GN=KXD1 PE=3 SV=1 79 179 9.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CMK9|KXD1_KLULA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KXD1 PE=3 SV=1 79 178 1.0E-09
sp|C5E000|KXD1_ZYGRC Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=KXD1 PE=3 SV=1 53 179 4.0E-09
sp|Q755A2|KXD1_ASHGO Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KXD1 PE=3 SV=1 41 178 2.0E-08
sp|Q6FS55|KXD1_CANGA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KXD1 PE=3 SV=1 70 179 5.0E-08
sp|E7Q3U6|KXD1_YEASB Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain FostersB) GN=KXD1 PE=3 SV=1 79 179 9.0E-07
sp|E7LUC9|KXD1_YEASV Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain VIN 13) GN=KXD1 PE=3 SV=1 79 179 9.0E-07
sp|P53158|KXD1_YEAST Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KXD1 PE=1 SV=1 79 179 9.0E-07
sp|E7NHM9|KXD1_YEASO Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain FostersO) GN=KXD1 PE=3 SV=1 79 179 9.0E-07
sp|E7KNF7|KXD1_YEASL Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=KXD1 PE=3 SV=1 79 179 9.0E-07
sp|E7KCH3|KXD1_YEASA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain AWRI796) GN=KXD1 PE=3 SV=1 79 179 9.0E-07
sp|C8Z8G8|KXD1_YEAS8 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=KXD1 PE=3 SV=1 79 179 9.0E-07
sp|A6ZUA0|KXD1_YEAS7 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain YJM789) GN=KXD1 PE=3 SV=1 79 179 9.0E-07
sp|B5VIP5|KXD1_YEAS6 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=KXD1 PE=3 SV=1 79 179 9.0E-07
sp|B3LHE5|KXD1_YEAS1 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=KXD1 PE=3 SV=1 79 179 9.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3271
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|14
Ophiocordyceps australis map64 (Brazil) OphauB2|2674
Ophiocordyceps camponoti-floridani Ophcf2|05786
Ophiocordyceps camponoti-rufipedis Ophun1|1138 (this protein)
Ophiocordyceps kimflemingae Ophio5|3058
Ophiocordyceps subramaniannii Hirsu2|5966

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1138
MSGPYSTVPYSIPMPVPSKGNQYPAYSQYSISPPECDDSYSSASGVGSYSNSGFTAPSSGYMACSAADYDSARSA
SGVDFQEYMQERFANSFNPIPLDRSMAVQAQTSGKLNAKHRELVELQKQAQARLAKTRERFNDGMRDAREVRGDL
EWTQKKVSSLQAKAARKHPKEHGKARARYPSPEC*
Coding >Ophun1|1138
ATGTCCGGCCCCTACTCCACCGTCCCCTACTCCATCCCCATGCCCGTCCCCTCCAAGGGCAACCAGTATCCAGCC
TACAGCCAGTACTCCATCTCCCCCCCAGAGTGCGACGACTCCTACAGCTCCGCCTCGGGCGTCGGCTCCTACAGC
AACAGCGGCTTCACTGCTCCCTCGTCTGGCTACATGGCCTGCTCTGCCGCCGACTACGACAGCGCCCGCTCAGCC
AGCGGCGTCGACTTCCAGGAGTACATGCAGGAACGCTTCGCCAACTCCTTCAACCCCATTCCCCTGGACCGCAGC
ATGGCCGTCCAGGCTCAGACATCCGGAAAGCTCAACGCCAAGCACCGCGAGCTCGTCGAGCTGCAGAAGCAGGCC
CAGGCCCGCCTCGCCAAGACGCGTGAGCGCTTCAATGACGGCATGCGAGACGCCCGCGAGGTTCGCGGCGACCTC
GAATGGACCCAGAAAAAGGTCAGCTCACTGCAGGCCAAAGCCGCCCGCAAGCACCCCAAGGAGCACGGCAAGGCC
CGCGCGCGGTACCCTTCTCCCGAGTGTTGA
Transcript >Ophun1|1138
ATGTCCGGCCCCTACTCCACCGTCCCCTACTCCATCCCCATGCCCGTCCCCTCCAAGGGCAACCAGTATCCAGCC
TACAGCCAGTACTCCATCTCCCCCCCAGAGTGCGACGACTCCTACAGCTCCGCCTCGGGCGTCGGCTCCTACAGC
AACAGCGGCTTCACTGCTCCCTCGTCTGGCTACATGGCCTGCTCTGCCGCCGACTACGACAGCGCCCGCTCAGCC
AGCGGCGTCGACTTCCAGGAGTACATGCAGGAACGCTTCGCCAACTCCTTCAACCCCATTCCCCTGGACCGCAGC
ATGGCCGTCCAGGCTCAGACATCCGGAAAGCTCAACGCCAAGCACCGCGAGCTCGTCGAGCTGCAGAAGCAGGCC
CAGGCCCGCCTCGCCAAGACGCGTGAGCGCTTCAATGACGGCATGCGAGACGCCCGCGAGGTTCGCGGCGACCTC
GAATGGACCCAGAAAAAGGTCAGCTCACTGCAGGCCAAAGCCGCCCGCAAGCACCCCAAGGAGCACGGCAAGGCC
CGCGCGCGGTACCCTTCTCCCGAGTGTTGA
Gene >Ophun1|1138
ATGTCCGGCCCCTACTCCACCGTCCCCTACTCCATCCCCATGCCCGTCCCCTCCAAGGGCAACCAGTATCCAGCC
TACAGCCAGTACTCCATCTCCCCCCCAGAGTGCGACGACTCCTACAGCTCCGCCTCGGGCGTCGGCTCCTACAGC
AACAGCGGCTTCACTGCTCCCTCGTCTGGCTACATGGCCTGCTCTGCCGCCGACTACGACAGCGCCCGCTCAGCC
AGCGGCGTCGACTTCCAGGAGTACATGCAGGAACGCTTCGCCAACTCCTTCAACCCCATTCCCCTGGACCGCAGC
ATGGCCGTCCAGGCTCAGACGTCAGTCTTCTCCCCCTCCCCCCCCCCCTTTCTCTCCTACACCTTGTTCATTAGG
TATACGAGCTGGCCGCTCATCCCGCTGCAGATCCGGAAAGCTCAACGCCAAGCACCGCGAGCTCGTCGAGCTGCA
GAAGCAGGCCCAGGCCCGCCTCGCCAAGACGCGTGAGCGCTTCAATGACGGCATGCGAGACGCCCGCGAGGTTCG
CGGCGACCTCGAATGGACCCAGAAAAAGGTCAGCTCACTGCAGGCCAAAGCCGCCCGCAAGCACCCCAAGGAGCA
CGGCAAGGCCCGCGCGCGGTACCCTTCTCCCGAGTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail