Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1134
Gene name
LocationContig_1424:153..2278
Strand+
Gene length (bp)2125
Transcript length (bp)1977
Coding sequence length (bp)1977
Protein length (aa) 659

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 6.1E+01 51 63
PF08238 Sel1 Sel1 repeat 1.5E+01 64 96
PF08238 Sel1 Sel1 repeat 2.0E-06 104 139
PF08238 Sel1 Sel1 repeat 4.1E+00 144 172
PF08238 Sel1 Sel1 repeat 4.2E-03 245 273
PF08238 Sel1 Sel1 repeat 1.9E-03 305 335
PF08238 Sel1 Sel1 repeat 4.7E-03 336 370
PF08238 Sel1 Sel1 repeat 2.8E+00 373 406
PF08238 Sel1 Sel1 repeat 6.3E-03 529 556
PF08238 Sel1 Sel1 repeat 2.2E-04 565 592

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 54 615 5.0E-81
sp|Q5XI05|SE1L2_RAT Protein sel-1 homolog 2 OS=Rattus norvegicus GN=Sel1l2 PE=2 SV=1 51 615 6.0E-79
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 51 615 1.0E-78
sp|Q9UBV2|SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3 51 615 7.0E-78
sp|Q9ESM7|SE1L1_MESAU Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1 51 615 2.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 54 615 5.0E-81
sp|Q5XI05|SE1L2_RAT Protein sel-1 homolog 2 OS=Rattus norvegicus GN=Sel1l2 PE=2 SV=1 51 615 6.0E-79
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 51 615 1.0E-78
sp|Q9UBV2|SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3 51 615 7.0E-78
sp|Q9ESM7|SE1L1_MESAU Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1 51 615 2.0E-75
sp|Q80Z70|SE1L1_RAT Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2 51 615 1.0E-74
sp|Q9Z2G6|SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l PE=1 SV=2 51 615 1.0E-74
sp|Q9LM25|HRD3A_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana GN=HRD3A PE=1 SV=1 100 640 9.0E-59
sp|O13875|YE1A_SCHPO Uncharacterized Sel1-like repeat-containing protein C1B3.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.10c PE=3 SV=4 50 619 9.0E-58
sp|Q10NT7|HRD3_ORYSJ ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Oryza sativa subsp. japonica GN=HRD3 PE=2 SV=1 100 658 4.0E-53
sp|Q6FNV5|HRD3_CANGA ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HRD3 PE=3 SV=1 55 617 5.0E-49
sp|Q9C6B6|HRD3B_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3B OS=Arabidopsis thaliana GN=HRD3B PE=3 SV=1 100 655 1.0E-46
sp|Q05787|HRD3_YEAST ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRD3 PE=1 SV=1 50 621 1.0E-44
sp|Q9USV0|HRD3_SCHPO Putative ERAD-associated E3 ubiquitin-protein ligase component OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC28F2.08c PE=3 SV=1 100 617 2.0E-34
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 66 559 8.0E-16
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 52 425 1.0E-14
sp|Q68CR1|SE1L3_HUMAN Protein sel-1 homolog 3 OS=Homo sapiens GN=SEL1L3 PE=1 SV=2 238 627 2.0E-13
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 228 597 8.0E-13
sp|Q80TS8|SE1L3_MOUSE Protein sel-1 homolog 3 OS=Mus musculus GN=Sel1l3 PE=2 SV=3 238 627 4.0E-12
sp|P77296|YBET_ECOLI Uncharacterized protein YbeT OS=Escherichia coli (strain K12) GN=ybeT PE=2 SV=1 237 375 2.0E-06
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 388 600 6.0E-06
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 100 363 7.0E-06
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 51 167 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3083
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4202
Ophiocordyceps australis map64 (Brazil) OphauB2|4430
Ophiocordyceps camponoti-floridani Ophcf2|03367
Ophiocordyceps camponoti-rufipedis Ophun1|1134 (this protein)
Ophiocordyceps kimflemingae Ophio5|2258
Ophiocordyceps subramaniannii Hirsu2|5354

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1134
MPRSAHARRRQSSGLIGFAFRYIMKTIPTRPASAPTQEKQAKPPGGALLHAVELLQQAADQNNSDALLMLAEFNF
FGNHSHPRNLDVAFRNYKKLAVHHGNTTAQYMLGLFHSTGIGGVVPRDQAKALLYYTFAAARGDTRAEMATAFRH
HNGIGAVKDCETAVKYYKRVADKAIKWYRSGPPGGMSWVHQSWRISDDEGGIYGEGASVSSSGINSRKASPHSDA
HAAIGDVIEYLDLVSQKGDSKASYNLGRIYYEGQRGLDKDFDLARRYFFLVASRYWKRDSRIVENHTKEIEKMAA
KAAGFIGRMYLRGDGVVQNPDRAKIWFDRGISLGDAQSQYGRGLMLLNGLGGKENVKLAMELFAASANQDYAPAQ
VQMGRLYLDQGGPDDVRIANNHFELAARHGNMEAHHYLAEMVYNGVGREKLCGVSLSYYKTVAEKAEPLVSSWAD
ANEAYEAGDLDTALLGYLMAAEQGYEKAQTNVAYMLDPLRSRMAVTGWKRRAADEGSLLNNAALALIYWTRSSRQ
ANVDALVKMGDYYFYGIGTGRDVGKAVQCYTGASDYSQSAQALYNLGWMHENGLGLTQDFHLAKRYYDHALEVNE
EAYLPVTLSLLKLRVRSAWNTLTHGPIHSIQDEPKKGKDWSLAEWIANFLEDDTLSAC*
Coding >Ophun1|1134
ATGCCGCGATCCGCGCACGCCCGGCGCCGACAGTCATCCGGCCTCATCGGCTTTGCCTTTCGCTACATCATGAAG
ACGATCCCGACAAGGCCCGCCTCGGCACCGACGCAGGAAAAGCAGGCAAAGCCCCCCGGCGGCGCCCTCCTCCAT
GCCGTTGAGCTACTTCAGCAGGCTGCCGATCAGAACAACTCGGATGCCCTGCTCATGCTGGCCGAGTTCAACTTT
TTCGGCAACCATAGCCACCCTCGAAATCTCGATGTCGCTTTTCGCAACTACAAGAAGCTGGCCGTCCATCACGGC
AACACCACGGCGCAGTACATGCTGGGCCTCTTCCACTCGACAGGCATCGGCGGCGTCGTTCCCCGCGACCAAGCC
AAGGCCCTTCTCTACTATACCTTTGCCGCCGCTAGAGGCGACACTCGTGCCGAGATGGCTACGGCCTTTCGACAC
CACAACGGCATAGGTGCAGTCAAGGACTGCGAGACTGCCGTCAAGTACTATAAACGAGTGGCCGACAAGGCCATT
AAGTGGTATCGCTCCGGGCCACCCGGCGGCATGTCGTGGGTACACCAGAGCTGGCGCATCTCGGACGATGAAGGA
GGCATCTACGGCGAGGGCGCCAGCGTTTCCAGCTCCGGCATCAACTCGCGCAAGGCGAGCCCTCACTCGGACGCG
CACGCTGCCATTGGCGACGTCATCGAATACCTGGACCTCGTGTCGCAAAAGGGCGACTCGAAGGCGTCGTACAAC
CTCGGACGCATCTACTACGAGGGCCAAAGGGGCCTCGACAAGGACTTTGACCTGGCGCGACGGTATTTTTTCCTC
GTGGCATCTCGGTATTGGAAGAGGGACAGCCGGATCGTGGAGAACCACACCAAGGAGATTGAAAAGATGGCGGCC
AAGGCGGCCGGCTTCATCGGACGCATGTACCTCCGGGGCGACGGTGTGGTGCAGAACCCGGACCGGGCCAAGATC
TGGTTCGACCGGGGCATCTCGCTTGGCGACGCGCAGTCGCAGTACGGGCGCGGCCTGATGCTACTCAACGGGCTG
GGCGGCAAGGAGAACGTCAAGCTGGCGATGGAGCTGTTTGCGGCTTCGGCCAACCAAGACTACGCGCCGGCGCAG
GTGCAGATGGGTCGTCTTTACCTGGACCAGGGCGGGCCGGACGACGTGCGCATCGCCAACAACCACTTTGAGCTC
GCGGCGCGGCACGGCAACATGGAGGCGCACCACTACCTGGCCGAGATGGTGTACAACGGCGTGGGCAGGGAGAAG
CTCTGCGGCGTGTCACTGAGTTACTACAAGACGGTGGCGGAGAAGGCGGAGCCGTTGGTGTCGTCGTGGGCAGAC
GCCAACGAGGCGTACGAGGCCGGTGACCTGGACACCGCCCTCCTCGGCTACCTGATGGCGGCGGAGCAGGGATAC
GAAAAGGCGCAGACCAACGTGGCATACATGCTGGACCCTCTTCGGTCGCGGATGGCGGTGACGGGGTGGAAGCGC
AGGGCGGCGGACGAAGGCAGCCTGCTCAACAACGCCGCGCTCGCCCTCATCTACTGGACGCGGTCGTCGCGACAG
GCCAACGTGGACGCGCTGGTCAAGATGGGCGACTACTACTTTTACGGCATCGGGACGGGACGCGACGTGGGCAAG
GCGGTGCAGTGCTACACGGGGGCGTCGGACTACTCACAGAGCGCGCAGGCACTCTACAACCTCGGCTGGATGCAC
GAGAACGGGCTGGGGCTGACGCAGGACTTTCACCTGGCGAAGCGCTACTACGACCACGCGCTCGAGGTCAACGAG
GAGGCGTATCTGCCGGTGACGCTGAGCCTGCTGAAGCTACGGGTGCGCAGCGCGTGGAACACGCTGACGCACGGG
CCGATCCATTCGATCCAGGACGAGCCGAAGAAGGGCAAGGACTGGTCGCTGGCGGAGTGGATCGCCAACTTTCTC
GAGGACGACACGCTGTCAGCGTGCTGA
Transcript >Ophun1|1134
ATGCCGCGATCCGCGCACGCCCGGCGCCGACAGTCATCCGGCCTCATCGGCTTTGCCTTTCGCTACATCATGAAG
ACGATCCCGACAAGGCCCGCCTCGGCACCGACGCAGGAAAAGCAGGCAAAGCCCCCCGGCGGCGCCCTCCTCCAT
GCCGTTGAGCTACTTCAGCAGGCTGCCGATCAGAACAACTCGGATGCCCTGCTCATGCTGGCCGAGTTCAACTTT
TTCGGCAACCATAGCCACCCTCGAAATCTCGATGTCGCTTTTCGCAACTACAAGAAGCTGGCCGTCCATCACGGC
AACACCACGGCGCAGTACATGCTGGGCCTCTTCCACTCGACAGGCATCGGCGGCGTCGTTCCCCGCGACCAAGCC
AAGGCCCTTCTCTACTATACCTTTGCCGCCGCTAGAGGCGACACTCGTGCCGAGATGGCTACGGCCTTTCGACAC
CACAACGGCATAGGTGCAGTCAAGGACTGCGAGACTGCCGTCAAGTACTATAAACGAGTGGCCGACAAGGCCATT
AAGTGGTATCGCTCCGGGCCACCCGGCGGCATGTCGTGGGTACACCAGAGCTGGCGCATCTCGGACGATGAAGGA
GGCATCTACGGCGAGGGCGCCAGCGTTTCCAGCTCCGGCATCAACTCGCGCAAGGCGAGCCCTCACTCGGACGCG
CACGCTGCCATTGGCGACGTCATCGAATACCTGGACCTCGTGTCGCAAAAGGGCGACTCGAAGGCGTCGTACAAC
CTCGGACGCATCTACTACGAGGGCCAAAGGGGCCTCGACAAGGACTTTGACCTGGCGCGACGGTATTTTTTCCTC
GTGGCATCTCGGTATTGGAAGAGGGACAGCCGGATCGTGGAGAACCACACCAAGGAGATTGAAAAGATGGCGGCC
AAGGCGGCCGGCTTCATCGGACGCATGTACCTCCGGGGCGACGGTGTGGTGCAGAACCCGGACCGGGCCAAGATC
TGGTTCGACCGGGGCATCTCGCTTGGCGACGCGCAGTCGCAGTACGGGCGCGGCCTGATGCTACTCAACGGGCTG
GGCGGCAAGGAGAACGTCAAGCTGGCGATGGAGCTGTTTGCGGCTTCGGCCAACCAAGACTACGCGCCGGCGCAG
GTGCAGATGGGTCGTCTTTACCTGGACCAGGGCGGGCCGGACGACGTGCGCATCGCCAACAACCACTTTGAGCTC
GCGGCGCGGCACGGCAACATGGAGGCGCACCACTACCTGGCCGAGATGGTGTACAACGGCGTGGGCAGGGAGAAG
CTCTGCGGCGTGTCACTGAGTTACTACAAGACGGTGGCGGAGAAGGCGGAGCCGTTGGTGTCGTCGTGGGCAGAC
GCCAACGAGGCGTACGAGGCCGGTGACCTGGACACCGCCCTCCTCGGCTACCTGATGGCGGCGGAGCAGGGATAC
GAAAAGGCGCAGACCAACGTGGCATACATGCTGGACCCTCTTCGGTCGCGGATGGCGGTGACGGGGTGGAAGCGC
AGGGCGGCGGACGAAGGCAGCCTGCTCAACAACGCCGCGCTCGCCCTCATCTACTGGACGCGGTCGTCGCGACAG
GCCAACGTGGACGCGCTGGTCAAGATGGGCGACTACTACTTTTACGGCATCGGGACGGGACGCGACGTGGGCAAG
GCGGTGCAGTGCTACACGGGGGCGTCGGACTACTCACAGAGCGCGCAGGCACTCTACAACCTCGGCTGGATGCAC
GAGAACGGGCTGGGGCTGACGCAGGACTTTCACCTGGCGAAGCGCTACTACGACCACGCGCTCGAGGTCAACGAG
GAGGCGTATCTGCCGGTGACGCTGAGCCTGCTGAAGCTACGGGTGCGCAGCGCGTGGAACACGCTGACGCACGGG
CCGATCCATTCGATCCAGGACGAGCCGAAGAAGGGCAAGGACTGGTCGCTGGCGGAGTGGATCGCCAACTTTCTC
GAGGACGACACGCTGTCAGCGTGCTGA
Gene >Ophun1|1134
ATGCCGCGATCCGCGCACGCCCGGCGCCGACAGTCATCCGGCCTCATCGGCTTTGCCTTTCGCTACATCATGAAG
ACGATCCCGACAAGGCCCGCCTCGGCACCGACGCAGGAAAAGCAGGCAAAGCCCCCCGGCGGCGCCCTCCTCCAT
GCCGTTGAGCTACTTCAGCAGGCTGCCGATCAGAACAACTCGGATGCCCTGCTCATGCTGGCCGAGTTCAACTTT
TTCGGCAACCATAGCCACCCTCGAAATCTCGATGTCGCTTTTCGCAACTACAAGAAGCTGGCCGTCCATCACGGC
AACACCACGGCGCAGTACATGCTGGGCCTCTTCCACTCGACAGGCATCGGCGGCGTCGTTCCCCGCGACCAAGCC
AAGGCCCTTCTCTACTATACCTTTGCCGCCGCTAGAGGCGACACTCGTGCCGAGATGGCTACGGCCTTTCGACAC
CACAACGGCATAGGTGCAGTCAAGGACTGCGAGACTGCCGTCAAGTACTATAAACGAGTGGCCGACAAGGCCATT
AAGTGGTATCGCTCCGGGCCACCCGGCGGCATGTCGTGGGTACACCAGAGCTGGCGCATCTCGGACGATGAAGGA
GGCATCTACGGCGAGGGCGCCAGCGTTTCCAGCTCCGGCATCAACTCGCGCAAGGCGAGCCCTCACTCGGACGCG
CACGCTGCCATTGGCGACGTCATCGAATACCTGGACCTCGTGTCGCAAAAGGGCGACTCGAAGGCGTCGTACAAC
CTCGGACGCATCTACTACGAGGGCCAAAGGGGCCTCGACAAGGACTTTGACCTGGCGCGACGGTATTTTTTCCTC
GTGGCATCTCGGTATTGGAAGAGGGACAGCCGGATCGTGGAGAACCACACCAAGGAGATTGAAAAGATGGCGGCC
AAGGCGGCCGGCTTCATCGGACGCATGTACCTCCGGGGCGACGGTGTGGTGCAGAACCCGGACCGGGCCAAGATC
TGGTTCGACCGGGGCATCTCGCTTGGCGACGCGCAGTCGCAGTACGGGCGCGGCCTGATGCTACTCAACGGGCTG
GGCGGCAAGGAGAACGTCAAGCTGGCGATGGAGCTGTTTGCGGCTTCGGCCAACCAAGACTACGCGCCGGCGCAG
GTGCAGATGGGTCGTCTTTACCTGGACCAGGGCGGGCCGGACGACGTGCGCATCGCCAACAACCACTTTGAGCTC
GCGGCGCGGCACGGCAACATGGAGGCGCACCACTACCTGGCCGAGATGGTGTACAACGGCGTGGGCAGGGAGAAG
CTCTGCGGCGTGTCACTGAGTTACTACAAGACGGTGGCGGAGAAGGCGGAGCCGTTGGTGTCGTCGTGGGCAGAC
GCCAACGAGGCGTACGAGGCCGGTGACCTGGACACCGCCCTCCTCGGCTACCTGATGGCGGCGGAGCAGGGATAC
GAAAAGGCGCAGACCAACGTGGCATACATGCTGGACCCTCTTCGGTCGCGGATGGCGGTGACGGGGTGGAAGCGC
AGGGCGGCGGACGAAGGCAGCCTGCTCAACAACGCCGCGCTCGCCCTCATCTACTGGACGCGGTCGTCGCGACAG
GCCAACGTGGACGCGCTGGTCAAGATGGGCGACTACTACTTTTACGGCATCGGGACGGGACGCGACGTGGGCAAG
GCGGTGCAGTGCTACACGGGGGCGTCGGACTACTCACAGAGCGCGCAGGCACTCTACAACCTCGGCTGGATGCAC
GAGAACGGGCTGGGGCTGACGCAGGACTTTCACCTGGCGAAGCGCTACTACGACCACGCGCTCGAGGTCAACGAG
GAGGCGTATCTGCCGGTGACGCTGAGCCTGCTGAAGCTACGGGTGCGCAGCGCGTGGAACACGCTGACGCACGGG
CCGATCCATTCGATCCAGGACGAGCCGAGTAAGGCGACCGGTCACCCTCGATGGAGAGAACCCATGCTGACGACG
GGCGCAGAGAAGGGCAAGGACTGGTCGCTGGCGGAGTGGATCGCCAACTTTCTCGAGGACGACACGCTGTCGTAC
GAGGCCGAGGCGCGCGAGCAGGACAGCCTGGAGGGGGGCGGGATGGGCGGCGGGGAGGAGGCGGCGCTGGAGGAC
GGGGGGGTGCTGGAGAGCGTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail