Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1131
Gene name
LocationContig_1421:320..1668
Strand+
Gene length (bp)1348
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08426 ICE2 ICE2 7.3E-152 7 420

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13909|YDW1_SCHPO Uncharacterized protein C23C11.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C11.01 PE=4 SV=1 13 431 3.0E-53
sp|P40499|ICE2_YEAST Protein ICE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICE2 PE=1 SV=1 13 419 1.0E-39

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22
2 34 53 19
3 66 88 22
4 139 161 22
5 174 196 22
6 206 225 19
7 232 249 17
8 302 324 22
9 358 380 22
10 400 422 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1131
MWWLFSILFGFVFLLSIVLSIPVAFDVGGRDSGLAYSLSLFIFYLAYSAIRIATSDGSRFGRSVSAVVRLSQWIV
IPALMIWALGQFAVDAGSTHWVERTVGGVFRSKSTTWTGWLFGKDGVLEVVMLGTWDGVLKYSGPMFQLLEGFCT
LLVIQAAGQITRWLVNRGRSDTWLILLLAFSGSVMASSVYFLWRVVQFPQIGNLDATLIGIAMTTAVFLCAYGIG
SGRGNPVESSLLFAYVVLCVYQIFTDYQPSDGTGQGDDQTAAQPDIPPLPPIIMASYSTLLHIVGSLPSALHSSL
ALLYAAFQTITPSVIISLTYRLLVLYSATRIIPSVRDLGARALMQEPDFDDSETANKVLGLLSYFSPSILVAVYT
SLLLQHFSTNGGPDGWTLRGGDVGGGMWRWVNVGLTMFLYGVELYLMDEQEHWKTD*
Coding >Ophun1|1131
ATGTGGTGGCTATTCAGCATCCTGTTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTCTCCATACCCGTTGCCTTT
GACGTTGGCGGTCGCGACAGCGGGCTCGCCTACAGCCTATCTCTCTTCATATTCTACCTCGCCTACTCGGCCATC
CGCATCGCCACCTCGGACGGGTCCCGCTTCGGACGCTCCGTGTCTGCCGTCGTTCGCCTATCGCAATGGATCGTC
ATACCGGCTCTGATGATATGGGCCCTCGGCCAGTTCGCCGTCGATGCGGGCAGCACCCACTGGGTCGAGAGGACC
GTCGGGGGCGTCTTTCGTTCCAAGAGCACCACCTGGACCGGCTGGCTGTTTGGCAAGGACGGCGTGTTGGAGGTG
GTCATGCTGGGCACCTGGGACGGCGTCCTCAAGTACTCGGGGCCCATGTTCCAGCTGCTAGAAGGCTTCTGCACC
CTGCTGGTCATCCAGGCCGCCGGCCAGATAACCCGCTGGCTCGTCAACCGTGGGAGGAGTGACACCTGGCTGATC
CTTCTCCTCGCCTTTTCCGGCTCCGTCATGGCCAGCTCCGTCTACTTTCTCTGGCGCGTTGTCCAGTTTCCGCAG
ATTGGCAATCTCGACGCCACCCTCATCGGCATCGCCATGACAACGGCCGTCTTCCTCTGCGCCTACGGGATCGGC
AGCGGCCGCGGCAACCCGGTCGAGAGCTCGCTTTTGTTTGCCTACGTCGTCCTCTGCGTCTACCAAATCTTCACC
GACTACCAACCGTCGGACGGGACCGGACAGGGTGATGATCAGACGGCGGCGCAACCCGACATTCCACCGCTGCCG
CCCATCATCATGGCGTCGTACTCGACGTTGCTGCATATTGTGGGCTCGCTGCCGTCGGCGCTGCACTCGTCGCTG
GCGCTGCTGTACGCTGCTTTCCAGACCATTACGCCGTCCGTCATCATTTCTCTCACCTATCGGCTCCTCGTCCTG
TACTCGGCCACCCGCATCATCCCTTCCGTCAGGGACCTCGGAGCGCGGGCGTTGATGCAGGAGCCGGACTTTGAT
GACTCGGAAACGGCCAACAAGGTGCTCGGCCTCTTGAGCTATTTCTCGCCGTCGATTCTGGTGGCTGTCTACACG
AGCCTTTTACTGCAGCATTTCTCGACAAACGGCGGGCCAGACGGATGGACGCTTCGGGGCGGCGACGTCGGAGGC
GGCATGTGGCGTTGGGTCAACGTCGGCCTGACCATGTTTCTCTACGGCGTCGAGCTTTACCTAATGGACGAGCAG
GAACACTGGAAGACGGATTAA
Transcript >Ophun1|1131
ATGTGGTGGCTATTCAGCATCCTGTTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTCTCCATACCCGTTGCCTTT
GACGTTGGCGGTCGCGACAGCGGGCTCGCCTACAGCCTATCTCTCTTCATATTCTACCTCGCCTACTCGGCCATC
CGCATCGCCACCTCGGACGGGTCCCGCTTCGGACGCTCCGTGTCTGCCGTCGTTCGCCTATCGCAATGGATCGTC
ATACCGGCTCTGATGATATGGGCCCTCGGCCAGTTCGCCGTCGATGCGGGCAGCACCCACTGGGTCGAGAGGACC
GTCGGGGGCGTCTTTCGTTCCAAGAGCACCACCTGGACCGGCTGGCTGTTTGGCAAGGACGGCGTGTTGGAGGTG
GTCATGCTGGGCACCTGGGACGGCGTCCTCAAGTACTCGGGGCCCATGTTCCAGCTGCTAGAAGGCTTCTGCACC
CTGCTGGTCATCCAGGCCGCCGGCCAGATAACCCGCTGGCTCGTCAACCGTGGGAGGAGTGACACCTGGCTGATC
CTTCTCCTCGCCTTTTCCGGCTCCGTCATGGCCAGCTCCGTCTACTTTCTCTGGCGCGTTGTCCAGTTTCCGCAG
ATTGGCAATCTCGACGCCACCCTCATCGGCATCGCCATGACAACGGCCGTCTTCCTCTGCGCCTACGGGATCGGC
AGCGGCCGCGGCAACCCGGTCGAGAGCTCGCTTTTGTTTGCCTACGTCGTCCTCTGCGTCTACCAAATCTTCACC
GACTACCAACCGTCGGACGGGACCGGACAGGGTGATGATCAGACGGCGGCGCAACCCGACATTCCACCGCTGCCG
CCCATCATCATGGCGTCGTACTCGACGTTGCTGCATATTGTGGGCTCGCTGCCGTCGGCGCTGCACTCGTCGCTG
GCGCTGCTGTACGCTGCTTTCCAGACCATTACGCCGTCCGTCATCATTTCTCTCACCTATCGGCTCCTCGTCCTG
TACTCGGCCACCCGCATCATCCCTTCCGTCAGGGACCTCGGAGCGCGGGCGTTGATGCAGGAGCCGGACTTTGAT
GACTCGGAAACGGCCAACAAGGTGCTCGGCCTCTTGAGCTATTTCTCGCCGTCGATTCTGGTGGCTGTCTACACG
AGCCTTTTACTGCAGCATTTCTCGACAAACGGCGGGCCAGACGGATGGACGCTTCGGGGCGGCGACGTCGGAGGC
GGCATGTGGCGTTGGGTCAACGTCGGCCTGACCATGTTTCTCTACGGCGTCGAGCTTTACCTAATGGACGAGCAG
GAACACTGGAAGACGGATTAA
Gene >Ophun1|1131
ATGTGGTGGCTATTCAGCATCCTGTTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTCTCCATACCCGTTGCCTTT
GACGTTGGCGGTCGCGACAGCGGGCTCGCCTACAGCCTATCTCTCTTCATATTCTACCTCGCCTACTCGGCCATC
CGCATCGCCACCTCGGACGGGTCCCGCTTCGGACGCTCCGTGTCTGCCGTCGTTCGCCTATCGCAATGGATCGTC
ATACCGGCTCTGATGATATGGGCCCTCGGCCAGTTCGCCGTCGATGCGGGCAGCACCCACTGGGTCGAGAGGACC
GTCGGGGGCGTCTTTCGTTCCAAGAGCACCACCTGGACCGGCTGGCTGTTTGGCAAGGACGGCGTGTTGGAGGTG
GTCATGCTGGGCACCTGGGACGGCGTCCTCAAGTACTCGGGGCCCATGTTCCAGCTGCTAGAAGGCTTCTGCACC
CTGCTGGTCATCCAGGCCGCCGGCCAGATAACCCGCTGGCTCGTCAACCGTGGGAGGAGTGACACCTGGCTGGTG
AGTCGACCATGTCTCCCCATGATTCGAAGCTGACGGAATCGCAAACCAGATCCTTCTCCTCGCCTTTTCCGGCTC
CGTCATGGCCAGCTCCGTCTACTTTCTCTGGCGCGTTGTCCAGTTTCCGCAGATTGGCAATCTCGACGCCACCCT
CATCGGCATCGCCATGACAACGGCCGTCTTCCTCTGCGCCTACGGGATCGGCAGCGGCCGCGGCAACCCGGTCGA
GAGCTCGCTTTTGTTTGCCTACGTCGTCCTCTGCGTCTACCAAATCTTCACCGACTACCAACCGTCGGACGGGAC
CGGACAGGGTGATGATCAGACGGCGGCGCAACCCGACATTCCACCGCTGCCGCCCATCATCATGGCGTCGTACTC
GACGTTGCTGCATATTGTGGGCTCGCTGCCGTCGGCGCTGCACTCGTCGCTGGCGCTGCTGTACGCTGCTTTCCA
GACCATTACGCCGTCCGTCATCATTTCTCTCACCTATCGGCTCCTCGTCCTGTACTCGGCCACCCGCATCATCCC
TTCCGTCAGGGACCTCGGAGCGCGGGCGTTGATGCAGGAGCCGGACTTTGATGACTCGGAAACGGCCAACAAGGT
GCTCGGCCTCTTGAGCTATTTCTCGCCGTCGATTCTGGTGGCTGTCTACACGAGCCTTTTACTGCAGCATTTCTC
GACAAACGGCGGGCCAGACGGATGGACGCTTCGGGGCGGCGACGTCGGAGGCGGCATGTGGCGTTGGGTCAACGT
CGGCCTGACCATGTTTCTCTACGGCGTCGAGCTTTACCTAATGGACGAGCAGGAACACTGGAAGACGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail