Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1126
Gene name
LocationContig_142:22011..23780
Strand-
Gene length (bp)1769
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11500 Cut12 Cut12 conserved domain 7.3E-42 136 262

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2458
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1335
Ophiocordyceps australis map64 (Brazil) OphauB2|6010
Ophiocordyceps camponoti-floridani Ophcf2|06800
Ophiocordyceps camponoti-rufipedis Ophun1|1126 (this protein)
Ophiocordyceps kimflemingae Ophio5|4130
Ophiocordyceps subramaniannii Hirsu2|3534

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1126
MLGWMLRGGENASNAESQGDATQLELPDTPAPVFAARALKSALFGTPARPDDSPRKQDTKASRRTMAKEDKAISS
TPSKPPGILLTPGTGTSRRKRVSFGANAASTTDNRAETRSKATTKAQDDFESDGECIEATAKAREEAGADESKAV
DDYSSDADWEEENDDDDGGFCTHDVTLDLNEPHSQSGRYWKGQFERYHQEAKAEMEKLLKYKQLAKSYARQKDAE
ALRLAERLRDERQRVIKMEKKIADNASQIVSKHDDAEGEPTELLAKLTKQTALAAEYRQRVHELETELDGLARQK
DQGSEAGGRRRRVMTAASPTTQKTLVETQRELRRARTQLRELDGLRHEVSLLKTRVKTAESQASTSSDRDDAAEA
RVSRLRNQLEESRAETKRKADEVRQLKKEFEAFRKESEAHEADTRAVLERAHDKISELKREMRTLRSEAEEDRRR
ATDGCMARDDDNDAHQPRLDGRKRRDKEDALTERTNGLAARWQPFVARSRGSTDSKPEMDPIPPQKDDDDGVKKP
RARSGLTLERREAALRVIESRMQDKRRRAHDKENRRPATQA*
Coding >Ophun1|1126
ATGCTTGGATGGATGCTACGGGGCGGCGAAAACGCGTCAAACGCTGAAAGCCAGGGAGACGCGACTCAGCTCGAG
CTGCCCGATACGCCTGCACCAGTATTTGCGGCTCGAGCGCTGAAGAGTGCTCTCTTTGGCACACCCGCGCGGCCC
GACGACTCGCCTCGCAAGCAGGATACAAAGGCGAGCCGGCGGACCATGGCAAAGGAAGACAAGGCTATATCAAGC
ACGCCTTCCAAGCCACCCGGAATCCTCCTCACGCCTGGGACTGGCACTTCACGACGGAAGCGCGTCTCTTTTGGT
GCTAATGCCGCCTCGACGACGGACAATCGCGCGGAGACAAGGTCAAAGGCCACGACCAAAGCTCAAGACGACTTC
GAGTCCGATGGCGAATGCATCGAGGCAACGGCAAAGGCCAGAGAAGAAGCTGGCGCTGATGAATCGAAAGCCGTC
GACGATTACAGTTCCGACGCTGATTGGGAAGAGGAAAACGACGATGACGACGGCGGCTTTTGCACGCACGACGTG
ACGCTGGATCTCAACGAGCCTCACTCGCAGTCCGGGCGGTACTGGAAGGGACAATTCGAGAGATATCACCAAGAA
GCCAAGGCAGAAATGGAGAAGCTGCTCAAGTATAAGCAACTGGCCAAATCCTATGCCCGGCAAAAGGACGCCGAG
GCCCTCCGGCTGGCCGAGCGGCTCCGTGACGAGCGGCAGCGGGTAATCAAGATGGAAAAGAAGATTGCAGACAAC
GCATCACAAATCGTCTCGAAGCACGACGACGCCGAGGGAGAGCCGACGGAACTGCTGGCCAAGCTCACCAAGCAG
ACCGCCCTCGCGGCAGAGTACCGACAGCGCGTGCACGAACTCGAGACGGAGCTGGACGGGCTCGCGCGGCAGAAG
GATCAAGGGTCCGAAGCCGGCGGTCGACGAAGACGAGTGATGACGGCCGCCTCGCCGACGACACAGAAGACGTTG
GTCGAGACGCAGCGAGAACTCCGACGAGCGCGGACGCAGCTGAGGGAGCTGGATGGACTCCGCCACGAGGTATCC
CTCCTCAAGACCCGTGTCAAGACGGCCGAGTCGCAGGCCAGCACGAGCAGCGACAGGGACGACGCCGCCGAGGCC
AGAGTCAGCAGGCTGAGAAACCAGCTGGAGGAGTCGAGAGCGGAGACGAAACGAAAGGCGGACGAGGTACGGCAG
CTCAAGAAGGAGTTTGAGGCCTTTCGAAAGGAGAGCGAGGCTCACGAGGCCGATACGCGTGCCGTTCTCGAGCGG
GCGCACGATAAGATTTCGGAGCTGAAGAGGGAGATGCGAACGCTGAGGTCTGAAGCGGAAGAGGATCGTCGACGA
GCCACGGATGGATGTATGGCGCGTGACGACGACAACGACGCCCATCAACCGCGGTTGGACGGACGCAAGAGACGC
GACAAGGAGGACGCGTTGACGGAGCGAACCAACGGACTGGCAGCAAGATGGCAACCATTCGTGGCGAGAAGCAGA
GGCTCAACCGACTCGAAACCCGAAATGGACCCCATCCCACCGCAAAAGGACGATGACGATGGCGTCAAAAAGCCC
CGAGCACGCAGCGGCCTAACCCTAGAACGCCGGGAAGCGGCACTTAGGGTTATCGAGAGCCGGATGCAGGACAAG
CGGAGGAGGGCACATGACAAGGAGAACAGGCGGCCTGCGACGCAAGCCTAA
Transcript >Ophun1|1126
ATGCTTGGATGGATGCTACGGGGCGGCGAAAACGCGTCAAACGCTGAAAGCCAGGGAGACGCGACTCAGCTCGAG
CTGCCCGATACGCCTGCACCAGTATTTGCGGCTCGAGCGCTGAAGAGTGCTCTCTTTGGCACACCCGCGCGGCCC
GACGACTCGCCTCGCAAGCAGGATACAAAGGCGAGCCGGCGGACCATGGCAAAGGAAGACAAGGCTATATCAAGC
ACGCCTTCCAAGCCACCCGGAATCCTCCTCACGCCTGGGACTGGCACTTCACGACGGAAGCGCGTCTCTTTTGGT
GCTAATGCCGCCTCGACGACGGACAATCGCGCGGAGACAAGGTCAAAGGCCACGACCAAAGCTCAAGACGACTTC
GAGTCCGATGGCGAATGCATCGAGGCAACGGCAAAGGCCAGAGAAGAAGCTGGCGCTGATGAATCGAAAGCCGTC
GACGATTACAGTTCCGACGCTGATTGGGAAGAGGAAAACGACGATGACGACGGCGGCTTTTGCACGCACGACGTG
ACGCTGGATCTCAACGAGCCTCACTCGCAGTCCGGGCGGTACTGGAAGGGACAATTCGAGAGATATCACCAAGAA
GCCAAGGCAGAAATGGAGAAGCTGCTCAAGTATAAGCAACTGGCCAAATCCTATGCCCGGCAAAAGGACGCCGAG
GCCCTCCGGCTGGCCGAGCGGCTCCGTGACGAGCGGCAGCGGGTAATCAAGATGGAAAAGAAGATTGCAGACAAC
GCATCACAAATCGTCTCGAAGCACGACGACGCCGAGGGAGAGCCGACGGAACTGCTGGCCAAGCTCACCAAGCAG
ACCGCCCTCGCGGCAGAGTACCGACAGCGCGTGCACGAACTCGAGACGGAGCTGGACGGGCTCGCGCGGCAGAAG
GATCAAGGGTCCGAAGCCGGCGGTCGACGAAGACGAGTGATGACGGCCGCCTCGCCGACGACACAGAAGACGTTG
GTCGAGACGCAGCGAGAACTCCGACGAGCGCGGACGCAGCTGAGGGAGCTGGATGGACTCCGCCACGAGGTATCC
CTCCTCAAGACCCGTGTCAAGACGGCCGAGTCGCAGGCCAGCACGAGCAGCGACAGGGACGACGCCGCCGAGGCC
AGAGTCAGCAGGCTGAGAAACCAGCTGGAGGAGTCGAGAGCGGAGACGAAACGAAAGGCGGACGAGGTACGGCAG
CTCAAGAAGGAGTTTGAGGCCTTTCGAAAGGAGAGCGAGGCTCACGAGGCCGATACGCGTGCCGTTCTCGAGCGG
GCGCACGATAAGATTTCGGAGCTGAAGAGGGAGATGCGAACGCTGAGGTCTGAAGCGGAAGAGGATCGTCGACGA
GCCACGGATGGATGTATGGCGCGTGACGACGACAACGACGCCCATCAACCGCGGTTGGACGGACGCAAGAGACGC
GACAAGGAGGACGCGTTGACGGAGCGAACCAACGGACTGGCAGCAAGATGGCAACCATTCGTGGCGAGAAGCAGA
GGCTCAACCGACTCGAAACCCGAAATGGACCCCATCCCACCGCAAAAGGACGATGACGATGGCGTCAAAAAGCCC
CGAGCACGCAGCGGCCTAACCCTAGAACGCCGGGAAGCGGCACTTAGGGTTATCGAGAGCCGGATGCAGGACAAG
CGGAGGAGGGCACATGACAAGGAGAACAGGCGGCCTGCGACGCAAGCCTAA
Gene >Ophun1|1126
ATGCTTGGATGGATGCTACGGGGCGGCGAAAACGCGTCAAACGCTGAAAGCCAGGGAGGTTCGTGCTGCTTTCCA
TGGGGAGCGGGCGTGCTGCGGCGATGCACGCTGAGATCAGGACCTTCACAGACGCGACTCAGCTCGAGCTGCCCG
ATACGCCTGCACCAGTATTTGCGGCTCGAGCGCTGAAGAGTGCTCTCTTTGGCACACCCGCGCGGCCCGACGACT
CGCCTCGCAAGCAGGATACAAAGGCGAGCCGGCGGACCATGGCAAAGGAAGACAAGGCTATATCAAGCACGCCTT
CCAAGCCACCCGGAATCCTCCTCACGCCTGGGACTGGCACTTCACGACGGAAGCGCGTCTCTTTTGGTGCTAATG
CCGCCTCGACGACGGACAATCGCGCGGAGACAAGGTCAAAGGCCACGACCAAAGCTCAAGACGACTTCGAGTCCG
ATGGCGAATGCATCGAGGCAACGGCAAAGGCCAGAGAAGAAGCTGGCGCTGATGAATCGAAAGCCGTCGACGATT
ACAGTTCCGACGCTGATTGGGAAGAGGAAAACGACGATGACGACGGCGGCTTTTGCACGCACGACGTGACGCTGG
ATCTCAACGAGCCTCACTCGCAGTCCGGGCGGTACTGGAAGGGACAATTCGAGAGATATCACCAAGAAGCCAAGG
CAGAAATGGAGAAGCTGCTCAAGTATAAGCAACTGGCCAAATCCTATGCCCGGCAAAAGGACGCCGAGGCCCTCC
GGCTGGCCGAGCGGCTCCGTGACGAGCGGCAGCGGGTAATCAAGATGGAAAAGAAGATTGCAGACAACGCATCAC
AAATCGTCTCGAAGCACGACGACGCCGAGGGAGAGCCGACGGAACTGCTGGCCAAGCTCACCAAGCAGACCGCCC
TCGCGGCAGAGTACCGACAGCGCGTGCACGAACTCGAGACGGAGCTGGACGGGCTCGCGCGGCAGAAGGATCAAG
GGTCCGAAGCCGGCGGTCGACGAAGACGAGTGATGACGGCCGCCTCGCCGACGACACAGAAGACGTTGGTCGAGA
CGCAGCGAGAACTCCGACGAGCGCGGACGCAGCTGAGGGAGCTGGATGGACTCCGCCACGAGGTATCCCTCCTCA
AGACCCGTGTCAAGACGGCCGAGTCGCAGGCCAGCACGAGCAGCGACAGGGACGACGCCGCCGAGGCCAGAGTCA
GCAGGCTGAGAAACCAGCTGGAGGAGTCGAGAGCGGAGACGAAACGAAAGGCGGACGAGGTACGGCAGCTCAAGA
AGGAGTTTGAGGCCTTTCGAAAGGAGAGCGAGGCTCACGAGGCCGATACGCGTGCCGTTCTCGAGCGGGCGCACG
ATAAGATTTCGGAGCTGAAGAGGGAGATGCGAACGCTGAGGTCTGAAGCGGAAGAGGATCGTCGACGAGCCACGG
ATGGATGTATGGCGCGTGACGACGACAACGACGCCCATCAACCGCGGTTGGACGGACGCAAGAGACGCGACAAGG
AGGACGCGTTGACGGAGCGAACCAACGGACTGGCAGCAAGATGGCAACCATTCGTGGCGAGAAGCAGAGGCTCAA
CCGACTCGAAACCCGAAATGGACCCCATCCCACCGCAAAAGGACGATGACGATGGCGTCAAAAAGCCCCGAGCAC
GCAGCGGCCTAACCCTAGAACGCCGGGAAGCGGCACTTAGGGTTATCGAGAGCCGGATGCAGGACAAGCGGAGGA
GGGCACATGACAAGGAGAACAGGCGGCCTGCGACGCAAGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail