Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1125
Gene name
LocationContig_142:20605..21643
Strand-
Gene length (bp)1038
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01730 UreF UreF 6.7E-21 135 299

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14016|UREF_SCHPO Uncharacterized urease accessory protein UreF-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29A4.13 PE=3 SV=1 96 345 5.0E-36
sp|Q0E3L5|UREF_ORYSJ Urease accessory protein F OS=Oryza sativa subsp. japonica GN=UREF PE=2 SV=2 106 343 6.0E-22
sp|E0ZS46|UREF_ORYSI Urease accessory protein F OS=Oryza sativa subsp. indica GN=UREF PE=2 SV=1 106 343 6.0E-22
sp|Q9XHZ3|UREF_ARATH Urease accessory protein F OS=Arabidopsis thaliana GN=UREF PE=2 SV=1 106 345 1.0E-18
sp|Q0BQ38|UREF_GRABC Urease accessory protein UreF OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ureF PE=3 SV=1 91 345 1.0E-07

GO

GO Term Description Terminal node
GO:0006807 nitrogen compound metabolic process Yes
GO:0016151 nickel cation binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5144
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1336
Ophiocordyceps australis map64 (Brazil) OphauB2|6011
Ophiocordyceps camponoti-rufipedis Ophun1|1125 (this protein)
Ophiocordyceps kimflemingae Ophio5|4129
Ophiocordyceps subramaniannii Hirsu2|3533

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1125
MAALLAQDDADAERLQAQVTELEARLAQARARLTAAQTPPAASTPASGARTPPATHPQSPGGGASTALQQQQQQQ
QQHLNLNLQSPPPPPPPPARSPPTTHFLLLLADSALPIGCFAFSSGLESFLAHGTRPTPDLAPFLAQTLSSTAST
SLPFFLAAHRHPDALVELDDELDAAVVCAVARRASVAQGRALLAVWERSFAGQMADDDDDDDGALRRFAALLRAS
SAAATAGCVDDDDVGPVQPSAHFAPLFGAVCAVAGLAARQAAYVFLLGHARAVVSAAVRAGVFGPYQAQRVLAAH
GLRDYIDALVEREWCTPSECAGQSVPLMDLWIGRHELLYSRIFNS*
Coding >Ophun1|1125
ATGGCCGCTCTCCTCGCCCAAGACGACGCCGACGCAGAACGCCTCCAGGCTCAAGTCACCGAGCTCGAAGCCCGC
CTAGCCCAAGCCCGCGCCCGTCTTACAGCAGCCCAGACGCCACCCGCAGCCTCGACGCCGGCTTCAGGGGCCCGA
ACACCACCAGCGACACACCCGCAAAGCCCTGGAGGTGGCGCCTCTACAGCCTTACAGCAGCAGCAGCAGCAGCAG
CAGCAGCATCTGAACCTCAACCTCCAATCACCACCACCACCACCACCACCACCCGCCAGATCCCCCCCAACCACA
CACTTCCTCCTCCTCCTCGCCGACTCAGCCCTCCCCATCGGCTGCTTCGCCTTCAGCAGCGGCCTAGAATCCTTC
CTCGCCCACGGCACCCGCCCAACCCCCGATCTAGCCCCCTTCCTCGCCCAAACGCTCTCCTCCACAGCCTCCACC
TCCCTCCCCTTCTTCCTCGCCGCCCACCGCCATCCAGACGCCCTCGTCGAGCTGGACGATGAGCTCGACGCCGCC
GTCGTCTGCGCCGTAGCGCGGAGGGCGAGCGTCGCGCAGGGACGGGCCTTGCTGGCTGTGTGGGAGAGGTCCTTT
GCTGGACAGATGGCTGACGATGACGATGACGATGACGGTGCGCTGCGTCGCTTTGCGGCTTTGCTTCGTGCTTCG
TCGGCTGCTGCTACGGCTGGGTGTGTTGATGACGATGATGTCGGTCCGGTGCAGCCTTCTGCCCACTTTGCTCCC
TTGTTCGGGGCTGTTTGTGCTGTTGCTGGTCTTGCTGCTCGACAGGCTGCCTACGTTTTCCTGCTGGGTCACGCG
AGGGCTGTCGTCTCGGCTGCCGTTCGGGCTGGTGTCTTTGGGCCATATCAGGCTCAGCGCGTGCTGGCTGCCCAT
GGGCTGCGGGACTATATCGACGCGCTGGTTGAGAGGGAGTGGTGCACGCCCTCTGAGTGTGCTGGCCAGAGCGTG
CCGCTGATGGATCTGTGGATTGGGCGTCATGAGCTGCTGTATTCGAGAATCTTCAACAGCTGA
Transcript >Ophun1|1125
ATGGCCGCTCTCCTCGCCCAAGACGACGCCGACGCAGAACGCCTCCAGGCTCAAGTCACCGAGCTCGAAGCCCGC
CTAGCCCAAGCCCGCGCCCGTCTTACAGCAGCCCAGACGCCACCCGCAGCCTCGACGCCGGCTTCAGGGGCCCGA
ACACCACCAGCGACACACCCGCAAAGCCCTGGAGGTGGCGCCTCTACAGCCTTACAGCAGCAGCAGCAGCAGCAG
CAGCAGCATCTGAACCTCAACCTCCAATCACCACCACCACCACCACCACCACCCGCCAGATCCCCCCCAACCACA
CACTTCCTCCTCCTCCTCGCCGACTCAGCCCTCCCCATCGGCTGCTTCGCCTTCAGCAGCGGCCTAGAATCCTTC
CTCGCCCACGGCACCCGCCCAACCCCCGATCTAGCCCCCTTCCTCGCCCAAACGCTCTCCTCCACAGCCTCCACC
TCCCTCCCCTTCTTCCTCGCCGCCCACCGCCATCCAGACGCCCTCGTCGAGCTGGACGATGAGCTCGACGCCGCC
GTCGTCTGCGCCGTAGCGCGGAGGGCGAGCGTCGCGCAGGGACGGGCCTTGCTGGCTGTGTGGGAGAGGTCCTTT
GCTGGACAGATGGCTGACGATGACGATGACGATGACGGTGCGCTGCGTCGCTTTGCGGCTTTGCTTCGTGCTTCG
TCGGCTGCTGCTACGGCTGGGTGTGTTGATGACGATGATGTCGGTCCGGTGCAGCCTTCTGCCCACTTTGCTCCC
TTGTTCGGGGCTGTTTGTGCTGTTGCTGGTCTTGCTGCTCGACAGGCTGCCTACGTTTTCCTGCTGGGTCACGCG
AGGGCTGTCGTCTCGGCTGCCGTTCGGGCTGGTGTCTTTGGGCCATATCAGGCTCAGCGCGTGCTGGCTGCCCAT
GGGCTGCGGGACTATATCGACGCGCTGGTTGAGAGGGAGTGGTGCACGCCCTCTGAGTGTGCTGGCCAGAGCGTG
CCGCTGATGGATCTGTGGATTGGGCGTCATGAGCTGCTGTATTCGAGAATCTTCAACAGCTGA
Gene >Ophun1|1125
ATGGCCGCTCTCCTCGCCCAAGACGACGCCGACGCAGAACGCCTCCAGGCTCAAGTCACCGAGCTCGAAGCCCGC
CTAGCCCAAGCCCGCGCCCGTCTTACAGCAGCCCAGACGCCACCCGCAGCCTCGACGCCGGCTTCAGGGGCCCGA
ACACCACCAGCGACACACCCGCAAAGCCCTGGAGGTGGCGCCTCTACAGCCTTACAGCAGCAGCAGCAGCAGCAG
CAGCAGCATCTGAACCTCAACCTCCAATCACCACCACCACCACCACCACCACCCGCCAGATCCCCCCCAACCACA
CACTTCCTCCTCCTCCTCGCCGACTCAGCCCTCCCCATCGGCTGCTTCGCCTTCAGCAGCGGCCTAGAATCCTTC
CTCGCCCACGGCACCCGCCCAACCCCCGATCTAGCCCCCTTCCTCGCCCAAACGCTCTCCTCCACAGCCTCCACC
TCCCTCCCCTTCTTCCTCGCCGCCCACCGCCATCCAGACGCCCTCGTCGAGCTGGACGATGAGCTCGACGCCGCC
GTCGTCTGCGCCGTAGCGCGGAGGGCGAGCGTCGCGCAGGGACGGGCCTTGCTGGCTGTGTGGGAGAGGTCCTTT
GCTGGACAGATGGCTGACGATGACGATGACGATGACGGTGCGCTGCGTCGCTTTGCGGCTTTGCTTCGTGCTTCG
TCGGCTGCTGCTACGGCTGGGTGTGTTGATGACGATGATGTCGGTCCGGTGCAGCCTTCTGCCCACTTTGCTCCC
TTGTTCGGGGCTGTTTGTGCTGTTGCTGGTCTTGCTGCTCGACAGGCTGCCTACGTTTTCCTGCTGGGTCACGCG
AGGGCTGTCGTCTCGGCTGCCGTTCGGGCTGGTGTCTTTGGGCCATATCAGGCTCAGCGCGTGCTGGCTGCCCAT
GGGCTGCGGGACTATATCGACGCGCTGGTTGAGAGGGAGTGGTGCACGCCCTCTGAGTGTGCTGGCCAGAGCGTG
CCGCTGATGGATCTGTGGATTGGGCGTCATGAGCTGCTGTATTCGAGAATCTTCAACAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail