Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1124
Gene name
LocationContig_142:19256..20502
Strand+
Gene length (bp)1246
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16131 Torus Torus domain 4.5E-41 48 153
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.2E-07 189 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q51TF7|CWC2_MAGO7 Pre-mRNA-splicing factor CWC2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CWC2 PE=3 SV=2 51 392 0.0E+00
sp|Q5BB35|CWC2_EMENI Pre-mRNA-splicing factor cwc2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc2 PE=3 SV=1 51 392 2.0E-175
sp|Q4WU07|CWC2_ASPFU Pre-mRNA-splicing factor cwc2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc2 PE=3 SV=1 5 392 5.0E-168
sp|Q6T412|CWC2_LEPMC Pre-mRNA-splicing factor CWC2 OS=Leptosphaeria maculans GN=CWC2 PE=3 SV=1 51 392 4.0E-157
sp|P87126|CWC2_SCHPO Pre-mRNA-splicing factor cwf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf2 PE=1 SV=2 50 391 6.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q51TF7|CWC2_MAGO7 Pre-mRNA-splicing factor CWC2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CWC2 PE=3 SV=2 51 392 0.0E+00
sp|Q5BB35|CWC2_EMENI Pre-mRNA-splicing factor cwc2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc2 PE=3 SV=1 51 392 2.0E-175
sp|Q4WU07|CWC2_ASPFU Pre-mRNA-splicing factor cwc2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc2 PE=3 SV=1 5 392 5.0E-168
sp|Q6T412|CWC2_LEPMC Pre-mRNA-splicing factor CWC2 OS=Leptosphaeria maculans GN=CWC2 PE=3 SV=1 51 392 4.0E-157
sp|P87126|CWC2_SCHPO Pre-mRNA-splicing factor cwf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf2 PE=1 SV=2 50 391 6.0E-118
sp|Q6C007|CWC2_YARLI Pre-mRNA-splicing factor CWC2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC2 PE=3 SV=1 50 308 5.0E-116
sp|Q6BLU8|CWC2_DEBHA Pre-mRNA-splicing factor CWC2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC2 PE=3 SV=2 47 391 2.0E-86
sp|P0CR14|CWC2_CRYNJ Pre-mRNA-splicing factor CWC2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC2 PE=3 SV=1 46 279 8.0E-80
sp|P0CR15|CWC2_CRYNB Pre-mRNA-splicing factor CWC2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC2 PE=3 SV=1 46 279 8.0E-80
sp|Q59W50|CWC2_CANAL Pre-mRNA-splicing factor CWC2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CWC2 PE=3 SV=1 50 392 1.0E-63
sp|Q4PA86|CWC2_USTMA Pre-mRNA-splicing factor CWC2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC2 PE=3 SV=2 50 393 1.0E-57
sp|Q6CT50|CWC2_KLULA Pre-mRNA-splicing factor CWC2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CWC2 PE=3 SV=1 48 390 6.0E-56
sp|Q54PH5|CWC2_DICDI Pre-mRNA-splicing factor cwc2 OS=Dictyostelium discoideum GN=cwc2 PE=3 SV=1 50 274 1.0E-52
sp|Q12046|CWC2_YEAST Pre-mRNA-splicing factor CWC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWC2 PE=1 SV=1 48 257 7.0E-48
sp|Q6FNR8|CWC2_CANGA Pre-mRNA-splicing factor CWC2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CWC2 PE=3 SV=1 48 277 1.0E-40
sp|Q9ZW36|C3H25_ARATH Zinc finger CCCH domain-containing protein 25 OS=Arabidopsis thaliana GN=At2g29580 PE=2 SV=1 114 287 1.0E-12
sp|Q9LNV5|C3H4_ARATH Zinc finger CCCH domain-containing protein 4 OS=Arabidopsis thaliana GN=At1g07360 PE=2 SV=1 114 251 5.0E-11
sp|Q5SNN4|C3H40_ORYSJ Zinc finger CCCH domain-containing protein 40 OS=Oryza sativa subsp. japonica GN=Os06g0170500 PE=2 SV=1 84 286 2.0E-10
sp|Q6Z358|C3H49_ORYSJ Zinc finger CCCH domain-containing protein 49 OS=Oryza sativa subsp. japonica GN=Os07g0281000 PE=2 SV=1 84 312 5.0E-10
sp|Q7ZXB5|RBM22_XENLA Pre-mRNA-splicing factor RBM22 OS=Xenopus laevis GN=rbm22 PE=2 SV=1 115 246 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2457
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1337
Ophiocordyceps australis map64 (Brazil) OphauB2|6012
Ophiocordyceps camponoti-floridani Ophcf2|06802
Ophiocordyceps camponoti-rufipedis Ophun1|1124 (this protein)
Ophiocordyceps kimflemingae Ophio5|4128
Ophiocordyceps subramaniannii Hirsu2|3532

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1124
MADAETAQMPKIGADGPPSLDSDAMALAKTETAVAAPAEKKKKVIRRRKRPARAQIDPDSISSEPPPQTGTVFNI
WYNKWSGGDRESYQQTHARGRCNIAEDSGYTKADSVAGSYFCLRFARGLCPMGQDCDYLHRLPSTLDLFSPNVDC
FGRDKFAGYRDDMGGVGSFMRQNRTVYVGRIHVTEDIEEIVARHFAEWGQIERVRVLNQRGVGFITYTNEANAEF
AKEAMAHQSLDHDEILNVRWATADPNPMAQKREARRIEEQAAEAIRKALPAQFVAEIEGKDPEATKRRKLESSYG
LEGYEAPDEVHYARGPDAVNPVGREGFEVPTQPLALPSSEPSTVDQTFSRGGGIFSDRTLAALSGARIKVPPKPK
PAATGPLVAYGSDDDDDDDA*
Coding >Ophun1|1124
ATGGCCGACGCAGAAACAGCACAGATGCCGAAAATCGGAGCGGACGGCCCTCCAAGTCTCGACAGCGATGCCATG
GCTCTGGCAAAGACAGAGACGGCCGTCGCCGCTCCGGCCGAGAAGAAGAAAAAGGTGATACGACGGAGGAAGCGA
CCGGCTCGAGCGCAGATCGACCCCGACAGCATCAGCTCCGAGCCTCCGCCCCAGACGGGCACCGTCTTCAACATC
TGGTACAACAAGTGGTCCGGCGGCGACCGCGAATCCTACCAGCAGACTCACGCGCGCGGGCGCTGCAACATTGCC
GAAGACAGCGGCTACACCAAGGCCGACAGCGTGGCGGGCAGCTACTTTTGTCTGCGGTTCGCGCGGGGACTTTGT
CCAATGGGTCAGGACTGCGACTATCTTCATCGGCTGCCTTCCACTCTGGACCTATTTAGTCCCAACGTCGACTGC
TTCGGGCGGGACAAGTTTGCTGGTTATCGTGACGACATGGGCGGCGTCGGAAGCTTCATGAGGCAGAACAGGACC
GTCTACGTCGGGCGAATCCACGTGACGGAAGATATCGAAGAGATTGTTGCGCGGCACTTTGCCGAATGGGGGCAG
ATTGAGCGCGTTCGCGTCCTCAATCAGAGAGGCGTCGGCTTCATCACCTACACCAACGAGGCGAACGCCGAGTTC
GCCAAGGAGGCCATGGCACATCAGTCACTCGATCACGACGAGATCCTCAACGTGCGCTGGGCCACAGCCGACCCG
AACCCGATGGCGCAGAAGCGCGAGGCGAGGAGGATTGAAGAGCAGGCGGCCGAAGCCATCCGCAAGGCGTTGCCA
GCCCAGTTCGTGGCCGAGATCGAAGGCAAGGACCCGGAGGCGACCAAGAGACGGAAGCTGGAGAGCAGCTACGGT
CTCGAGGGCTACGAGGCACCCGACGAAGTGCACTATGCGCGGGGGCCGGACGCCGTGAACCCCGTTGGGCGGGAA
GGGTTCGAAGTTCCGACGCAGCCACTGGCGCTGCCGAGCTCGGAGCCATCGACAGTCGATCAGACGTTCTCACGA
GGAGGAGGCATCTTCTCGGACCGCACCCTGGCAGCTCTGAGCGGGGCGAGGATCAAAGTGCCACCGAAGCCCAAG
CCAGCGGCGACGGGGCCGTTGGTGGCGTATGGCAGCGATGACGACGACGATGACGACGCGTGA
Transcript >Ophun1|1124
ATGGCCGACGCAGAAACAGCACAGATGCCGAAAATCGGAGCGGACGGCCCTCCAAGTCTCGACAGCGATGCCATG
GCTCTGGCAAAGACAGAGACGGCCGTCGCCGCTCCGGCCGAGAAGAAGAAAAAGGTGATACGACGGAGGAAGCGA
CCGGCTCGAGCGCAGATCGACCCCGACAGCATCAGCTCCGAGCCTCCGCCCCAGACGGGCACCGTCTTCAACATC
TGGTACAACAAGTGGTCCGGCGGCGACCGCGAATCCTACCAGCAGACTCACGCGCGCGGGCGCTGCAACATTGCC
GAAGACAGCGGCTACACCAAGGCCGACAGCGTGGCGGGCAGCTACTTTTGTCTGCGGTTCGCGCGGGGACTTTGT
CCAATGGGTCAGGACTGCGACTATCTTCATCGGCTGCCTTCCACTCTGGACCTATTTAGTCCCAACGTCGACTGC
TTCGGGCGGGACAAGTTTGCTGGTTATCGTGACGACATGGGCGGCGTCGGAAGCTTCATGAGGCAGAACAGGACC
GTCTACGTCGGGCGAATCCACGTGACGGAAGATATCGAAGAGATTGTTGCGCGGCACTTTGCCGAATGGGGGCAG
ATTGAGCGCGTTCGCGTCCTCAATCAGAGAGGCGTCGGCTTCATCACCTACACCAACGAGGCGAACGCCGAGTTC
GCCAAGGAGGCCATGGCACATCAGTCACTCGATCACGACGAGATCCTCAACGTGCGCTGGGCCACAGCCGACCCG
AACCCGATGGCGCAGAAGCGCGAGGCGAGGAGGATTGAAGAGCAGGCGGCCGAAGCCATCCGCAAGGCGTTGCCA
GCCCAGTTCGTGGCCGAGATCGAAGGCAAGGACCCGGAGGCGACCAAGAGACGGAAGCTGGAGAGCAGCTACGGT
CTCGAGGGCTACGAGGCACCCGACGAAGTGCACTATGCGCGGGGGCCGGACGCCGTGAACCCCGTTGGGCGGGAA
GGGTTCGAAGTTCCGACGCAGCCACTGGCGCTGCCGAGCTCGGAGCCATCGACAGTCGATCAGACGTTCTCACGA
GGAGGAGGCATCTTCTCGGACCGCACCCTGGCAGCTCTGAGCGGGGCGAGGATCAAAGTGCCACCGAAGCCCAAG
CCAGCGGCGACGGGGCCGTTGGTGGCGTATGGCAGCGATGACGACGACGATGACGACGCGTGA
Gene >Ophun1|1124
ATGGCCGACGCAGAAACAGCACAGATGCCGAAAATCGGAGCGGACGGCCCTCCAAGTCTCGACAGCGATGCCATG
GCTCTGGCAAAGACAGAGACGGCCGTCGCCGCTCCGGCCGAGAAGAAGAAAAAGGTGATACGACGGAGGAAGCGA
CCGGCTCGAGCGCAGATCGACCCCGACAGCATCAGCTCCGAGCCTCCGCCCCAGACGGGCACCGTCTTCAACATC
TGGTACAACAAGTGGTCCGGCGGCGACCGCGAATCCTACCAGCAGACTCACGCGCGCGGGCGCTGCAACATTGCC
GAAGACAGCGGCTACACCAAGGCCGACAGCGTGGCGGGCAGCTACTTTTGTCTGCGGTTCGCGCGGGGACTTTGT
CCAATGGGTCAGGACTGCGACTATCTTCATCGGCTGCCTTCCACTCTGGACCTATTTAGTCCCAACGTCGACTGC
TTCGGGCGGGACAAGTTTGCTGGTTATCGTGACGACATGGGCGGCGTCGGAAGCTTCATGAGGCAGAACAGGACC
GTCTACGTCGGGCGAATCCACGTGACGGAAGATATCGAAGAGATTGTTGCGCGGCACTTTGCCGAATGGGGGCAG
ATTGAGCGCGGTGAGTGCCCAAGCCTGTCACGCGAAGGAAGTCGACACGTTTACTCACCTACTTCAAGTTCGCGT
CCTCAATCAGAGAGGCGTCGGCTTCATCACCTACACCAACGAGGCGAACGCCGAGTTCGCCAAGGAGGCCATGGC
ACATCAGTCACTCGATCACGACGAGATCCTCAACGTGCGCTGGGCCACAGCCGACCCGAACCCGATGGCGCAGAA
GCGCGAGGCGAGGAGGATTGAAGAGCAGGCGGCCGAAGCCATCCGCAAGGCGTTGCCAGCCCAGTTCGTGGCCGA
GATCGAAGGCAAGGACCCGGAGGCGACCAAGAGACGGAAGCTGGAGAGCAGCTACGGTCTCGAGGGCTACGAGGC
ACCCGACGAAGTGCACTATGCGCGGGGGCCGGACGCCGTGAACCCCGTTGGGCGGGAAGGGTTCGAAGTTCCGAC
GCAGCCACTGGCGCTGCCGAGCTCGGAGCCATCGACAGTCGATCAGACGTTCTCACGAGGAGGAGGCATCTTCTC
GGACCGCACCCTGGCAGCTCTGAGCGGGGCGAGGATCAAAGTGCCACCGAAGCCCAAGCCAGCGGCGACGGGGCC
GTTGGTGGCGTATGGCAGCGATGACGACGACGATGACGACGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail