Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1119
Gene name
LocationContig_142:8394..10123
Strand-
Gene length (bp)1729
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.3E-22 68 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 43 505 5.0E-33
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 47 504 9.0E-26
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 54 235 2.0E-13
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 50 232 2.0E-08
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 68 259 8.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 43 505 5.0E-33
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 47 504 9.0E-26
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 54 235 2.0E-13
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 50 232 2.0E-08
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 68 259 8.0E-08
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 48 227 1.0E-07
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 68 233 4.0E-07
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 43 314 6.0E-07
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 66 227 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1119
MKFTSLAAAALVGSVYGDPSKPSKGKPSGPDCCRRLSTVVPTIYYPPTSPRYNESITNRWSGNSILHPSCVVAPK
SAQDVSQALRLLSKYNCPFAVKGGGHNPNPGANSIDNGVSIDLSRLDSTVLASDRSHVSLGAGGSWGHAYDAFNG
SDIGFPGALCRDVSVGAVALGGGSSIFQARKGWVVDQILNYEVVLSSGRIINANERNHADLFRALKGGFTNLGIV
TKIDLAAFNFGTFWDSEVVLSLNGPQANKSTMLDIISKTTVDFIANNAKDTANGLHVAVTSVAKNKTDLAILAIT
NTDNVANPPAAKPIRAVPNQRANVERHGKISGYVKAISGFQPKGFRQVTASITIKNDYQTLREIWDASDAVYQAT
PQNDKIAWIVELYPQPAIMQSHASTHGGNLLGLSQNPHDQIVIWLSSRWKEPSVDEIMQKASREFISAVEAIARK
HGTLEPFIYVNFAASFQDPLCGYGADNVAHLRRMAAKYDPRGVFQRLMNGGFKLCEARCRRGY*
Coding >Ophun1|1119
ATGAAGTTTACCAGTCTCGCGGCTGCAGCCCTCGTCGGGTCCGTCTACGGAGACCCGTCTAAGCCCTCGAAAGGG
AAACCATCCGGACCTGACTGCTGCCGTCGACTATCCACCGTCGTCCCTACCATCTACTACCCCCCAACATCCCCC
CGATACAACGAATCAATCACCAACCGCTGGTCCGGCAACTCAATCCTCCACCCCTCCTGCGTCGTCGCCCCCAAA
TCCGCCCAAGACGTCTCCCAAGCCCTCCGCCTCCTCTCGAAATACAACTGCCCTTTCGCCGTCAAGGGCGGTGGC
CACAACCCCAACCCCGGAGCCAACAGCATCGACAACGGCGTCTCCATCGATCTCAGCCGTCTGGACTCAACCGTC
CTCGCCTCTGATCGCTCGCACGTTAGCCTCGGGGCGGGCGGCTCTTGGGGCCACGCGTACGATGCTTTCAACGGC
AGTGATATCGGCTTCCCCGGCGCTCTTTGCAGGGATGTCAGTGTCGGCGCCGTTGCTCTCGGCGGGGGATCTTCC
ATCTTTCAGGCTAGGAAGGGGTGGGTAGTTGATCAGATCCTCAACTACGAAGTCGTGCTATCATCCGGCCGCATC
ATCAACGCCAACGAAAGGAACCACGCAGATCTCTTCCGCGCGCTCAAGGGCGGCTTCACGAACCTGGGCATCGTC
ACCAAAATCGACCTCGCAGCCTTCAACTTCGGAACCTTTTGGGACTCGGAAGTCGTCCTCTCCCTCAACGGCCCG
CAAGCCAACAAGTCAACCATGCTCGACATCATCAGCAAAACAACCGTCGACTTCATCGCCAACAACGCAAAGGAC
ACGGCAAACGGCCTGCACGTTGCCGTCACATCCGTGGCGAAGAACAAGACGGACCTCGCCATCCTCGCCATCACC
AACACGGATAACGTCGCCAACCCCCCCGCCGCGAAACCCATCCGCGCCGTCCCCAACCAGAGAGCCAACGTGGAG
CGTCACGGCAAGATATCGGGCTACGTCAAAGCCATCAGCGGCTTCCAACCAAAGGGATTCCGCCAAGTCACAGCA
AGCATAACCATCAAAAACGACTACCAAACCCTCCGCGAAATATGGGACGCCTCCGACGCAGTCTACCAAGCAACC
CCCCAAAACGACAAAATCGCCTGGATCGTCGAACTCTACCCCCAACCCGCAATCATGCAATCCCACGCCTCAACC
CACGGGGGAAACCTCCTCGGCCTCTCCCAAAACCCCCACGATCAAATCGTCATCTGGCTCTCCTCCCGCTGGAAA
GAACCCTCCGTCGACGAAATCATGCAAAAAGCCTCCCGCGAATTCATCTCGGCCGTCGAGGCCATCGCCCGCAAA
CACGGCACGCTGGAGCCCTTCATCTACGTCAACTTCGCCGCCTCGTTCCAGGATCCGCTCTGCGGGTACGGGGCC
GACAACGTCGCTCATCTGCGCCGCATGGCTGCCAAGTACGATCCCAGGGGTGTCTTTCAGCGGCTTATGAACGGG
GGGTTTAAGCTTTGCGAGGCTCGTTGTCGGAGGGGATATTAG
Transcript >Ophun1|1119
ATGAAGTTTACCAGTCTCGCGGCTGCAGCCCTCGTCGGGTCCGTCTACGGAGACCCGTCTAAGCCCTCGAAAGGG
AAACCATCCGGACCTGACTGCTGCCGTCGACTATCCACCGTCGTCCCTACCATCTACTACCCCCCAACATCCCCC
CGATACAACGAATCAATCACCAACCGCTGGTCCGGCAACTCAATCCTCCACCCCTCCTGCGTCGTCGCCCCCAAA
TCCGCCCAAGACGTCTCCCAAGCCCTCCGCCTCCTCTCGAAATACAACTGCCCTTTCGCCGTCAAGGGCGGTGGC
CACAACCCCAACCCCGGAGCCAACAGCATCGACAACGGCGTCTCCATCGATCTCAGCCGTCTGGACTCAACCGTC
CTCGCCTCTGATCGCTCGCACGTTAGCCTCGGGGCGGGCGGCTCTTGGGGCCACGCGTACGATGCTTTCAACGGC
AGTGATATCGGCTTCCCCGGCGCTCTTTGCAGGGATGTCAGTGTCGGCGCCGTTGCTCTCGGCGGGGGATCTTCC
ATCTTTCAGGCTAGGAAGGGGTGGGTAGTTGATCAGATCCTCAACTACGAAGTCGTGCTATCATCCGGCCGCATC
ATCAACGCCAACGAAAGGAACCACGCAGATCTCTTCCGCGCGCTCAAGGGCGGCTTCACGAACCTGGGCATCGTC
ACCAAAATCGACCTCGCAGCCTTCAACTTCGGAACCTTTTGGGACTCGGAAGTCGTCCTCTCCCTCAACGGCCCG
CAAGCCAACAAGTCAACCATGCTCGACATCATCAGCAAAACAACCGTCGACTTCATCGCCAACAACGCAAAGGAC
ACGGCAAACGGCCTGCACGTTGCCGTCACATCCGTGGCGAAGAACAAGACGGACCTCGCCATCCTCGCCATCACC
AACACGGATAACGTCGCCAACCCCCCCGCCGCGAAACCCATCCGCGCCGTCCCCAACCAGAGAGCCAACGTGGAG
CGTCACGGCAAGATATCGGGCTACGTCAAAGCCATCAGCGGCTTCCAACCAAAGGGATTCCGCCAAGTCACAGCA
AGCATAACCATCAAAAACGACTACCAAACCCTCCGCGAAATATGGGACGCCTCCGACGCAGTCTACCAAGCAACC
CCCCAAAACGACAAAATCGCCTGGATCGTCGAACTCTACCCCCAACCCGCAATCATGCAATCCCACGCCTCAACC
CACGGGGGAAACCTCCTCGGCCTCTCCCAAAACCCCCACGATCAAATCGTCATCTGGCTCTCCTCCCGCTGGAAA
GAACCCTCCGTCGACGAAATCATGCAAAAAGCCTCCCGCGAATTCATCTCGGCCGTCGAGGCCATCGCCCGCAAA
CACGGCACGCTGGAGCCCTTCATCTACGTCAACTTCGCCGCCTCGTTCCAGGATCCGCTCTGCGGGTACGGGGCC
GACAACGTCGCTCATCTGCGCCGCATGGCTGCCAAGTACGATCCCAGGGGTGTCTTTCAGCGGCTTATGAACGGG
GGGTTTAAGCTTTGCGAGGCTCGTTGTCGGAGGGGATATTAG
Gene >Ophun1|1119
ATGAAGTTTACCAGTCTCGCGGCTGCAGCCCTCGTCGGGTCCGTCTACGGAGACCCGTCTAAGCCCTCGAAAGGG
AAACCATCCGGACCTGACTGCGTGAGTTGCTCTCCATATCCCATCAACATGACTGAAGCCAACTCTCCTCCAGTG
CCGTCGACTATCCACCGTCGTCCCTACCATCTACTACCCCCCAACATCCCCCCGATACAACGAATCAATCACCAA
CCGCTGGTCCGGCAACTCAATCCTCCACCCCTCCTGCGTCGTCGCCCCCAAATCCGCCCAAGACGTCTCCCAAGC
CCTCCGCCTCCTCTCGAAATACAACTGCCCTTTCGCCGTCAAGGGCGGTGGCCACAACCCCAACCCCGGAGCCAA
CAGCATCGACAACGGCGTCTCCATCGATCTCAGCCGTCTGGACTCAACCGTCCTCGCCTCTGATCGCTCGCACGT
TAGCCTCGGGGCGGGCGGCTCTTGGGGCCACGCGTACGATGCTTTCAACGGCAGTGATATCGGCTTCCCCGGCGC
TCTTTGCAGGGATGTCAGTGTCGGCGCCGTTGCTCTCGGCGGGGGATCTTCCATCTTTCAGGCTAGGAAGGGGTG
GGTAGTTGATCAGATCCTCAACTACGAAGTCGTGCTATCATCCGGCCGCATCATCAACGCCAACGAAAGGAACCA
CGCAGATCTCTTCCGCGCGCTCAAGGGCGGCTTCACGAACCTGGGCATCGTCACCAAAATCGACCTCGCAGCCTT
CAACTTCGGAACCTTTTGGGACTCGGAAGTCGTCCTCTCCCTCAACGGCCCGCAAGCCAACAAGTCAACCATGCT
CGACATCATCAGCAAAACAACCGTCGACTTCATCGCCAACAACGCAAAGGACACGGCAAACGGCCTGCACGTTGC
CGTCACATCCGTGGCGAAGAACAAGACGGACCTCGCCATCCTCGCCATCACCAACACGGATAACGTCGCCAACCC
CCCCGCCGCGAAACCCATCCGCGCCGTCCCCAACCAGAGAGCCAACGTGGAGCGTCACGGCAAGATATCGGGCTA
CGTCAAAGCCATCAGCGGCTTCCAACCAAAGGGATTCCGGTGCGTGCGGGTCTACCGTGTCATGATGCCATCCTC
AACGAGTGAATACTGACTTCATCCCCCCTTGATAGCCAAGTCACAGCAAGCATAACCATCAAAAACGACTACCAA
ACCCTCCGCGAAATATGGGACGCCTCCGACGCAGTCTACCAAGCAACCCCCCAAAACGACAAAATCGCCTGGATC
GTCGAACTCTACCCCCAACCCGCAATCATGCAATCCCACGCCTCAACCCACGGGGGAAACCTCCTCGGCCTCTCC
CAAAACCCCCACGATCAAATCGGTAACACACCACTCCACCCCTCTCCCTCTGCAAACCCTCACTGATTCCCACCG
TGAAAATATAGTCATCTGGCTCTCCTCCCGCTGGAAAGAACCCTCCGTCGACGAAATCATGCAAAAAGCCTCCCG
CGAATTCATCTCGGCCGTCGAGGCCATCGCCCGCAAACACGGCACGCTGGAGCCCTTCATCTACGTCAACTTCGC
CGCCTCGTTCCAGGATCCGCTCTGCGGGTACGGGGCCGACAACGTCGCTCATCTGCGCCGCATGGCTGCCAAGTA
CGATCCCAGGGGTGTCTTTCAGCGGCTTATGAACGGGGGGTTTAAGCTTTGCGAGGCTCGTTGTCGGAGGGGATA
TTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail