Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1112
Gene name
LocationContig_1415:615..1959
Strand+
Gene length (bp)1344
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.5E-20 5 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74852|YQ92_SCHPO Uncharacterized MFS-type transporter C18.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.02 PE=3 SV=1 7 159 6.0E-15
sp|P59845|VACHB_DANRE Probable vesicular acetylcholine transporter-B OS=Danio rerio GN=slc18a3b PE=2 SV=1 3 265 1.0E-08
sp|O17444|VACHT_DROME Vesicular acetylcholine transporter OS=Drosophila melanogaster GN=VAChT PE=2 SV=2 1 267 1.0E-07
sp|Q16572|VACHT_HUMAN Vesicular acetylcholine transporter OS=Homo sapiens GN=SLC18A3 PE=2 SV=2 3 267 8.0E-07
sp|Q62666|VACHT_RAT Vesicular acetylcholine transporter OS=Rattus norvegicus GN=Slc18a3 PE=2 SV=2 3 267 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74852|YQ92_SCHPO Uncharacterized MFS-type transporter C18.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.02 PE=3 SV=1 7 159 6.0E-15
sp|P59845|VACHB_DANRE Probable vesicular acetylcholine transporter-B OS=Danio rerio GN=slc18a3b PE=2 SV=1 3 265 1.0E-08
sp|O17444|VACHT_DROME Vesicular acetylcholine transporter OS=Drosophila melanogaster GN=VAChT PE=2 SV=2 1 267 1.0E-07
sp|Q16572|VACHT_HUMAN Vesicular acetylcholine transporter OS=Homo sapiens GN=SLC18A3 PE=2 SV=2 3 267 8.0E-07
sp|Q62666|VACHT_RAT Vesicular acetylcholine transporter OS=Rattus norvegicus GN=Slc18a3 PE=2 SV=2 3 267 8.0E-07
sp|Q91498|VACHT_TORMA Vesicular acetylcholine transporter OS=Torpedo marmorata PE=2 SV=2 19 119 8.0E-07
sp|P81721|VACHT_TORCA Vesicular acetylcholine transporter OS=Torpedo californica PE=2 SV=2 19 119 9.0E-07
sp|Q91514|VACHT_TORTO Vesicular acetylcholine transporter OS=Torpedo torpedo PE=2 SV=1 19 119 9.0E-07
sp|O35304|VACHT_MOUSE Vesicular acetylcholine transporter OS=Mus musculus GN=Slc18a3 PE=2 SV=1 3 267 1.0E-06
sp|P34711|UNC17_CAEEL Vesicular acetylcholine transporter unc-17 OS=Caenorhabditis elegans GN=unc-17 PE=1 SV=1 3 101 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 20 38 18
2 48 67 19
3 74 96 22
4 106 128 22
5 170 192 22
6 196 218 22
7 225 244 19
8 254 276 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1112
MKDRLAGYLTDAILSKSRPFILCLTTLHASTLLFFLGSRPSHVLTARALQGASQAFVWVSGMALLASRVDEADRL
GLFVGYLFMAGTIGELVGPVIGGPLYEGFGHWAVFVFVEVLLGVDVGLRVAVGDKSDRGVVKTASVQENCQTETD
ALLHQQNPEVIITNNLHWNCLASITAETIATIPLVVLSRFAWSPSASGAVLFALILPSVLGPVIGRFAARHGPRW
WNVAALAACGSCTAGLALVSGEAPFVLLVAGIGFCVTAIINANTASVLAVARSLDRQPAVRRPLGVTTGSLLGGL
NTAWSLGLEEPVFVLERYLRCHKW*
Coding >Ophun1|1112
ATGAAAGATCGGCTGGCAGGCTACCTCACCGACGCAATCCTCTCCAAATCCCGCCCCTTCATCCTCTGCCTCACA
ACCCTCCACGCCTCCACCCTCCTCTTCTTCCTCGGCTCCCGTCCCTCCCACGTCCTCACCGCCCGCGCCCTCCAA
GGCGCATCGCAGGCCTTCGTCTGGGTCTCCGGCATGGCGCTGCTGGCCTCGCGCGTCGACGAGGCCGACCGGCTG
GGCCTGTTCGTCGGATACCTCTTCATGGCTGGCACCATTGGCGAGCTCGTCGGGCCGGTCATCGGGGGGCCGTTG
TATGAGGGGTTTGGACATTGGGCTGTTTTTGTCTTTGTTGAGGTTTTGCTGGGGGTTGATGTTGGGTTGCGGGTT
GCGGTTGGGGATAAGTCGGATAGGGGGGTTGTTAAGACGGCTTCGGTTCAGGAGAACTGCCAGACAGAAACTGAC
GCCCTCCTCCATCAACAGAATCCCGAAGTCATCATCACCAACAACCTCCACTGGAACTGCCTCGCCAGCATAACC
GCCGAAACCATAGCCACCATCCCCCTCGTCGTCCTCAGCCGCTTCGCCTGGTCCCCCTCAGCCAGCGGCGCCGTC
CTCTTCGCCCTCATCCTCCCCTCCGTCCTCGGCCCCGTCATCGGCCGCTTCGCCGCTCGGCACGGTCCCCGCTGG
TGGAACGTTGCGGCTCTTGCTGCCTGCGGCTCGTGCACTGCTGGGCTGGCGCTCGTCTCCGGAGAGGCCCCCTTT
GTTCTCCTGGTGGCTGGCATTGGCTTCTGCGTCACTGCCATTATCAATGCTAATACGGCTTCTGTTCTCGCCGTG
GCCCGTTCGCTTGATCGCCAGCCCGCTGTTCGTCGTCCGTTGGGCGTCACTACCGGCAGTTTGCTGGGCGGTCTC
AACACCGCTTGGAGTCTGGGGCTGGAGGAGCCTGTGTTTGTTCTGGAGCGTTATCTGCGTTGTCACAAGTGGTAG
Transcript >Ophun1|1112
ATGAAAGATCGGCTGGCAGGCTACCTCACCGACGCAATCCTCTCCAAATCCCGCCCCTTCATCCTCTGCCTCACA
ACCCTCCACGCCTCCACCCTCCTCTTCTTCCTCGGCTCCCGTCCCTCCCACGTCCTCACCGCCCGCGCCCTCCAA
GGCGCATCGCAGGCCTTCGTCTGGGTCTCCGGCATGGCGCTGCTGGCCTCGCGCGTCGACGAGGCCGACCGGCTG
GGCCTGTTCGTCGGATACCTCTTCATGGCTGGCACCATTGGCGAGCTCGTCGGGCCGGTCATCGGGGGGCCGTTG
TATGAGGGGTTTGGACATTGGGCTGTTTTTGTCTTTGTTGAGGTTTTGCTGGGGGTTGATGTTGGGTTGCGGGTT
GCGGTTGGGGATAAGTCGGATAGGGGGGTTGTTAAGACGGCTTCGGTTCAGGAGAACTGCCAGACAGAAACTGAC
GCCCTCCTCCATCAACAGAATCCCGAAGTCATCATCACCAACAACCTCCACTGGAACTGCCTCGCCAGCATAACC
GCCGAAACCATAGCCACCATCCCCCTCGTCGTCCTCAGCCGCTTCGCCTGGTCCCCCTCAGCCAGCGGCGCCGTC
CTCTTCGCCCTCATCCTCCCCTCCGTCCTCGGCCCCGTCATCGGCCGCTTCGCCGCTCGGCACGGTCCCCGCTGG
TGGAACGTTGCGGCTCTTGCTGCCTGCGGCTCGTGCACTGCTGGGCTGGCGCTCGTCTCCGGAGAGGCCCCCTTT
GTTCTCCTGGTGGCTGGCATTGGCTTCTGCGTCACTGCCATTATCAATGCTAATACGGCTTCTGTTCTCGCCGTG
GCCCGTTCGCTTGATCGCCAGCCCGCTGTTCGTCGTCCGTTGGGCGTCACTACCGGCAGTTTGCTGGGCGGTCTC
AACACCGCTTGGAGTCTGGGGCTGGAGGAGCCTGTGTTTGTTCTGGAGCGTTATCTGCGTTGTCACAAGTGGTAG
Gene >Ophun1|1112
ATGAAAGATCGTTCCCTTTCTCCCCGAATACCTCGCAACCCGCATTCAAATCCGCCAAGATCAAAGTCCGCCTCC
CCTAAACAAGCAAGACAAGAACGAAACTCACAAGCCCAGTCCCTACATGGACCGCCCTCTCTCTCTCAGCCTTTG
CCATTGCCTCTCTCCTCTGCAGCTGTACGCACCCAACATTGACCTTCCATCTCCCCATCAAAGAGATAAAAACAA
CAGCTAATTAAGAAGAATCAGGGCTGGCAGGCTACCTCACCGACGCAATCCTCTCCAAATCCCGCCCCTTCATCC
TCTGCCTCACAACCCTCCACGCCTCCACCCTCCTCTTCTTCCTCGGCTCCCGTCCCTCCCACGTCCTCACCGCCC
GCGCCCTCCAAGGCGCATCGCAGGCCTTCGTCTGGGTCTCCGGCATGGCGCTGCTGGCCTCGCGCGTCGACGAGG
CCGACCGGCTGGGCCTGTTCGTCGGATACCTCTTCATGGCTGGCACCATTGGCGAGCTCGTCGGGCCGGTCATCG
GGGGGCCGTTGTATGAGGGGTTTGGACATTGGGCTGTTTTTGTCTTTGTTGAGGTTTTGCTGGGGGTTGATGTTG
GGTTGCGGGTTGCGGTTGGGGATAAGTCGGATAGGGGGGTTGTTAAGACGGCTTCGGTTCAGGAGAACTGCCAGA
CAGAAACTGACGCCCTCCTCCATCAACAGAATCCCGAAGTCATCATCACCAACAACCTCCACTGGAACTGCCTCG
CCAGCATAACCGCCGAAACCATAGCCGTAACCGTCCGCTGCGGCCTCGAAGCAGTACCACGCCTCAACTCTCCAT
CCGTACAACACAGCTAACAAGAAACACACAGACCATCCCCCTCGTCGTCCTCAGCCGCTTCGCCTGGTCCCCCTC
AGCCAGCGGCGCCGTCCTCTTCGCCCTCATCCTCCCCTCCGTCCTCGGCCCCGTCATCGGCCGCTTCGCCGCTCG
GCACGGTCCCCGCTGGTGGAACGTTGCGGCTCTTGCTGCCTGCGGCTCGTGCACTGCTGGGCTGGCGCTCGTCTC
CGGAGAGGCCCCCTTTGTTCTCCTGGTGGCTGGCATTGGCTTCTGCGTCACTGCCATTATCAATGCTAATACGGC
TTCTGTTCTCGCCGTGGCCCGTTCGCTTGATCGCCAGCCCGCTGTTCGTCGTCCGTTGGGCGTCACTACCGGCAG
TTTGCTGGGCGGTCTCAACACCGCTTGGAGTCTGGGTATGCTGCTCGGGCCTGCCTGTGCTGCTGCTGTGCCCTT
TGACTCTCGGGAGGGCTGGAGGAGCCTGTGTTTGTTCTGGAGCGTTATCTGCGTTGTCACAAGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail