Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|111
Gene name
LocationContig_1001:2521..4861
Strand-
Gene length (bp)2340
Transcript length (bp)1989
Coding sequence length (bp)1989
Protein length (aa) 663

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 5.3E-18 31 184
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 5.2E-19 507 649

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 497 662 3.0E-50
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 493 653 5.0E-45
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 490 652 1.0E-39
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 6 190 3.0E-37
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 494 654 3.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 497 662 3.0E-50
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 493 653 5.0E-45
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 490 652 1.0E-39
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 6 190 3.0E-37
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 494 654 3.0E-36
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 492 654 7.0E-36
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 8 192 1.0E-35
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 8 196 5.0E-35
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 508 653 2.0E-34
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 510 658 2.0E-34
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 501 658 4.0E-33
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 32 192 6.0E-33
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 499 655 6.0E-33
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 8 212 2.0E-32
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 8 228 2.0E-32
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 8 234 3.0E-32
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 10 192 4.0E-32
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 491 654 1.0E-31
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 8 189 3.0E-31
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 491 645 3.0E-31
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 489 658 1.0E-30
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 496 654 2.0E-28
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 491 649 5.0E-28
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 492 655 5.0E-27
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 32 198 1.0E-26
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 502 650 1.0E-24
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 31 192 3.0E-23
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 8 195 4.0E-23
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 8 197 8.0E-23
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 504 649 1.0E-21
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 8 192 4.0E-21
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 32 184 4.0E-20
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 8 198 1.0E-19
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 487 651 2.0E-16
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 32 192 2.0E-12
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 457 651 2.0E-12
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 32 245 4.0E-11
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 31 188 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 29 51 22
3 61 83 22
4 90 112 22
5 127 149 22
6 162 184 22
7 506 528 22
8 540 559 19
9 574 596 22
10 603 625 22
11 629 651 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|111
MVATYSWLNVLLVFVPIGIAVANVKGIHGGIVFAMNAIAIVPLAGLLSFATESVAVNMGDSLGALLNVTFGNAVE
LIILIALVKDQIRIVQASLLGSILANLLLILGMGFFLGGLRYREQVYNSTVTQVSACLLSLSVISLMLPTAFHAS
FNDRRRADEESLKISRGTSVILLLVYVIYLLFQLKSHAYMYESTPQHIVDAEAIPGPAAAWLDTSSSDNCSSASD
DSDDSDRSRDTMRRKMKKVLRGGRRRKSSTASTDTGDTSAIRNGSLGIVNGSAIDEMTSEVSLKRPVPISREASD
ETEEVVEDDKPRKRKRHHRLPHRHHRRRHGKHRHDELDPLETDTARTGAATSAGEPHRVDFALRTGAGRGIIAPG
SAAPTAAAAAAVTTNAATENPSQAPKSRPFPAFRGVSVKSLTPTVFAQRPEMVVATPQSRPGPVPRVRYGIRRTN
SLPDRLRNQFQGRPPGAMFPARPSLTGTSISAGVGPGPHGDGEDEESPPHLSRSAAVILLLMTTGLVAVCAEFLV
GSIEAVTRTSTIGEIFIGLIILPIVGNAAEHVTAITVAMKNKMDLAIGVAVGSSIQIALFVTPLVVILGWIIGRE
MSLFFTLFETVSLFASAFIVNFLVLDGRSNYLEGALLCAVYVIIAIVAFFFPSERETSTWGS*
Coding >Ophun1|111
ATGGTCGCCACCTACAGCTGGCTCAACGTGCTACTCGTCTTCGTGCCCATTGGCATCGCCGTCGCCAATGTCAAG
GGCATCCATGGCGGCATCGTCTTCGCCATGAATGCAATCGCCATTGTCCCGCTCGCTGGTCTGCTGAGCTTCGCT
ACCGAGTCGGTCGCTGTGAATATGGGTGATTCGCTGGGCGCTCTGCTCAACGTGACGTTTGGCAATGCTGTTGAG
CTCATCATCTTAATCGCTCTCGTCAAGGACCAAATCCGCATCGTCCAGGCCTCTCTGCTCGGGTCCATCTTGGCC
AACCTCTTGCTGATTCTCGGCATGGGCTTCTTCCTCGGCGGACTGCGATACCGCGAGCAGGTCTACAACAGCACC
GTGACGCAAGTCAGTGCCTGTCTGCTCAGCCTGAGCGTCATCAGTCTGATGCTGCCGACGGCCTTCCACGCGTCC
TTCAACGACCGCCGACGCGCCGACGAGGAGTCTCTGAAAATCAGTCGCGGAACCAGCGTGATTCTCCTTCTCGTA
TACGTCATCTACCTGCTCTTCCAGCTCAAGTCGCACGCCTACATGTATGAGTCGACGCCCCAGCACATCGTCGAC
GCCGAGGCCATCCCTGGTCCCGCCGCGGCCTGGCTCGATACGTCGAGTTCGGACAACTGTTCGTCCGCAAGCGAC
GATTCGGACGACTCGGACCGGTCGCGGGACACGATGAGACGCAAGATGAAAAAGGTGCTGCGCGGCGGCCGGAGG
CGCAAATCTTCCACCGCCTCCACAGATACGGGCGACACCAGCGCCATCCGCAACGGCTCGCTCGGCATCGTCAAC
GGGAGCGCCATCGACGAGATGACGTCGGAGGTGTCGTTGAAACGACCCGTGCCGATATCCCGCGAGGCGTCGGAC
GAGACGGAGGAGGTCGTCGAAGATGACAAGCCTCGTAAGCGCAAGAGGCATCACCGTCTCCCCCATCGCCACCAC
AGGCGCCGTCACGGGAAGCACCGTCACGACGAGCTTGACCCTCTGGAGACGGACACGGCCCGTACCGGCGCCGCT
ACTTCTGCCGGGGAACCGCACCGGGTCGACTTTGCTCTGCGCACGGGCGCCGGGCGCGGCATCATAGCTCCCGGT
TCGGCCGCTCCCACGGCGGCGGCTGCGGCTGCGGTGACGACGAATGCAGCGACGGAGAACCCGAGTCAAGCCCCC
AAGAGCAGACCGTTCCCCGCCTTCCGCGGCGTGTCGGTCAAGAGCCTGACGCCGACCGTCTTCGCCCAGAGGCCC
GAGATGGTCGTGGCGACGCCTCAGTCCCGGCCCGGGCCAGTGCCTCGCGTACGGTACGGCATCCGGCGCACCAAC
TCGCTCCCGGATCGGTTGAGGAACCAGTTCCAAGGCCGGCCACCCGGGGCCATGTTTCCCGCGCGGCCGTCATTG
ACGGGCACCAGCATCAGCGCAGGCGTCGGCCCGGGGCCGCACGGGGACGGCGAGGACGAGGAATCTCCGCCTCAC
CTCTCGCGGTCGGCGGCCGTGATTCTTCTGCTGATGACTACGGGTCTCGTCGCTGTCTGTGCCGAGTTCTTGGTG
GGCTCCATCGAGGCGGTGACGAGGACGTCGACGATTGGTGAGATCTTCATCGGCCTCATCATACTGCCCATCGTC
GGCAACGCGGCGGAGCACGTGACTGCCATCACGGTGGCCATGAAGAACAAGATGGACCTGGCGATTGGGGTGGCG
GTTGGCAGCTCCATCCAGATTGCGCTGTTTGTGACGCCGCTGGTGGTGATTTTGGGCTGGATCATCGGGCGAGAG
ATGTCGCTCTTCTTCACGCTGTTTGAGACGGTCAGCCTGTTCGCGTCGGCCTTTATCGTCAACTTTCTGGTGCTG
GACGGGCGCAGCAACTATCTCGAGGGGGCGCTGCTGTGCGCCGTCTACGTCATCATTGCCATTGTCGCGTTTTTC
TTTCCGAGCGAGCGGGAGACGAGCACGTGGGGGAGTTAG
Transcript >Ophun1|111
ATGGTCGCCACCTACAGCTGGCTCAACGTGCTACTCGTCTTCGTGCCCATTGGCATCGCCGTCGCCAATGTCAAG
GGCATCCATGGCGGCATCGTCTTCGCCATGAATGCAATCGCCATTGTCCCGCTCGCTGGTCTGCTGAGCTTCGCT
ACCGAGTCGGTCGCTGTGAATATGGGTGATTCGCTGGGCGCTCTGCTCAACGTGACGTTTGGCAATGCTGTTGAG
CTCATCATCTTAATCGCTCTCGTCAAGGACCAAATCCGCATCGTCCAGGCCTCTCTGCTCGGGTCCATCTTGGCC
AACCTCTTGCTGATTCTCGGCATGGGCTTCTTCCTCGGCGGACTGCGATACCGCGAGCAGGTCTACAACAGCACC
GTGACGCAAGTCAGTGCCTGTCTGCTCAGCCTGAGCGTCATCAGTCTGATGCTGCCGACGGCCTTCCACGCGTCC
TTCAACGACCGCCGACGCGCCGACGAGGAGTCTCTGAAAATCAGTCGCGGAACCAGCGTGATTCTCCTTCTCGTA
TACGTCATCTACCTGCTCTTCCAGCTCAAGTCGCACGCCTACATGTATGAGTCGACGCCCCAGCACATCGTCGAC
GCCGAGGCCATCCCTGGTCCCGCCGCGGCCTGGCTCGATACGTCGAGTTCGGACAACTGTTCGTCCGCAAGCGAC
GATTCGGACGACTCGGACCGGTCGCGGGACACGATGAGACGCAAGATGAAAAAGGTGCTGCGCGGCGGCCGGAGG
CGCAAATCTTCCACCGCCTCCACAGATACGGGCGACACCAGCGCCATCCGCAACGGCTCGCTCGGCATCGTCAAC
GGGAGCGCCATCGACGAGATGACGTCGGAGGTGTCGTTGAAACGACCCGTGCCGATATCCCGCGAGGCGTCGGAC
GAGACGGAGGAGGTCGTCGAAGATGACAAGCCTCGTAAGCGCAAGAGGCATCACCGTCTCCCCCATCGCCACCAC
AGGCGCCGTCACGGGAAGCACCGTCACGACGAGCTTGACCCTCTGGAGACGGACACGGCCCGTACCGGCGCCGCT
ACTTCTGCCGGGGAACCGCACCGGGTCGACTTTGCTCTGCGCACGGGCGCCGGGCGCGGCATCATAGCTCCCGGT
TCGGCCGCTCCCACGGCGGCGGCTGCGGCTGCGGTGACGACGAATGCAGCGACGGAGAACCCGAGTCAAGCCCCC
AAGAGCAGACCGTTCCCCGCCTTCCGCGGCGTGTCGGTCAAGAGCCTGACGCCGACCGTCTTCGCCCAGAGGCCC
GAGATGGTCGTGGCGACGCCTCAGTCCCGGCCCGGGCCAGTGCCTCGCGTACGGTACGGCATCCGGCGCACCAAC
TCGCTCCCGGATCGGTTGAGGAACCAGTTCCAAGGCCGGCCACCCGGGGCCATGTTTCCCGCGCGGCCGTCATTG
ACGGGCACCAGCATCAGCGCAGGCGTCGGCCCGGGGCCGCACGGGGACGGCGAGGACGAGGAATCTCCGCCTCAC
CTCTCGCGGTCGGCGGCCGTGATTCTTCTGCTGATGACTACGGGTCTCGTCGCTGTCTGTGCCGAGTTCTTGGTG
GGCTCCATCGAGGCGGTGACGAGGACGTCGACGATTGGTGAGATCTTCATCGGCCTCATCATACTGCCCATCGTC
GGCAACGCGGCGGAGCACGTGACTGCCATCACGGTGGCCATGAAGAACAAGATGGACCTGGCGATTGGGGTGGCG
GTTGGCAGCTCCATCCAGATTGCGCTGTTTGTGACGCCGCTGGTGGTGATTTTGGGCTGGATCATCGGGCGAGAG
ATGTCGCTCTTCTTCACGCTGTTTGAGACGGTCAGCCTGTTCGCGTCGGCCTTTATCGTCAACTTTCTGGTGCTG
GACGGGCGCAGCAACTATCTCGAGGGGGCGCTGCTGTGCGCCGTCTACGTCATCATTGCCATTGTCGCGTTTTTC
TTTCCGAGCGAGCGGGAGACGAGCACGTGGGGGAGTTAG
Gene >Ophun1|111
ATGGTCGCCACCTACAGCTGGCTCAACGTGCTACTCGTCTTCGTGCCCATTGGCATCGCCGTCGCCAATGTCAAG
GGCATCCATGGCGGCATCGTCTTCGCCATGAATGCAATCGCCATTGTCCCGCTCGCTGGTCTGCTGAGCTTCGCT
ACCGAGTCGGTCGCTGTGAATATGGGTGATTCGCTGGGCGCTCTGCTCAACGTGACGTTTGGCAATGCTGTTGAG
CTCATCATCTTGTGCGTTGGCTGTTTGGGAGGTGTGAGTGAGAGCTCTGACTGACAAATTCTGACAGCATGTAAG
TCACGAGCTGCCACGCGTGTGAAGCAACTTTGACCTGACCGGGCCGACGCCTGCAGAATCGCTCTCGTCAAGGTG
TGTGCGCTCCTACAATTGGGATACACGAGTCTCCAGCTGACGAGAATCAGGACCAAATCCGCATCGTCCAGGCCT
CTCTGCTCGGGTCCATCTTGGCCAACCTCTTGCTGATTCTCGGCATGGGCTTCTTCCTCGGCGGACTGCGATACC
GCGAGCAGGTGCGGCTTCGTCGTCGCCATCAGCAGTCCAGGACGCTGACCTTGATAGGTCTACAACAGCACCGTG
ACGCAAGTCAGTGCCTGTCTGCTCAGCCTGAGCGTCATCAGTCTGATGCTGCCGGTAAGATTCCCTCTTCCGTCA
CGATTCCGATCATGTCACTCACTCACGCGTGCCAAGACGGCCTTCCACGCGTCCTTCAACGACCGCCGACGCGCC
GACGAGGAGTCTCTGAAAATCAGTCGCGGAACCAGCGTGGTGAGTTGAGCCGCTGCTGTCTAGGCGAACCTCCTT
CCGTTGACACTCCTTTCTCTCTCTCCTCCCCGGCAGATTCTCCTTCTCGTATACGTCATCTACCTGCTCTTCCAG
CTCAAGTCGCACGCCTACATGTATGAGTCGACGCCCCAGCACATCGTCGACGCCGAGGCCATCCCTGGTCCCGCC
GCGGCCTGGCTCGATACGTCGAGTTCGGACAACTGTTCGTCCGCAAGCGACGATTCGGACGACTCGGACCGGTCG
CGGGACACGATGAGACGCAAGATGAAAAAGGTGCTGCGCGGCGGCCGGAGGCGCAAATCTTCCACCGCCTCCACA
GATACGGGCGACACCAGCGCCATCCGCAACGGCTCGCTCGGCATCGTCAACGGGAGCGCCATCGACGAGATGACG
TCGGAGGTGTCGTTGAAACGACCCGTGCCGATATCCCGCGAGGCGTCGGACGAGACGGAGGAGGTCGTCGAAGAT
GACAAGCCTCGTAAGCGCAAGAGGCATCACCGTCTCCCCCATCGCCACCACAGGCGCCGTCACGGGAAGCACCGT
CACGACGAGCTTGACCCTCTGGAGACGGACACGGCCCGTACCGGCGCCGCTACTTCTGCCGGGGAACCGCACCGG
GTCGACTTTGCTCTGCGCACGGGCGCCGGGCGCGGCATCATAGCTCCCGGTTCGGCCGCTCCCACGGCGGCGGCT
GCGGCTGCGGTGACGACGAATGCAGCGACGGAGAACCCGAGTCAAGCCCCCAAGAGCAGACCGTTCCCCGCCTTC
CGCGGCGTGTCGGTCAAGAGCCTGACGCCGACCGTCTTCGCCCAGAGGCCCGAGATGGTCGTGGCGACGCCTCAG
TCCCGGCCCGGGCCAGTGCCTCGCGTACGGTACGGCATCCGGCGCACCAACTCGCTCCCGGATCGGTTGAGGAAC
CAGTTCCAAGGCCGGCCACCCGGGGCCATGTTTCCCGCGCGGCCGTCATTGACGGGCACCAGCATCAGCGCAGGC
GTCGGCCCGGGGCCGCACGGGGACGGCGAGGACGAGGAATCTCCGCCTCACCTCTCGCGGTCGGCGGCCGTGATT
CTTCTGCTGATGACTACGGGTCTCGTCGCTGTCTGTGCCGAGTTCTTGGTGGGCTCCATCGAGGCGGTGACGAGG
ACGTCGACGATTGGTGAGATCTTCATCGGCCTCATCATACTGCCCATCGTCGGCAACGCGGCGGAGCACGTGACT
GCCATCACGGTGGCCATGAAGAACAAGATGGACCTGGCGATTGGGGTGGCGGTTGGCAGCTCCATCCAGATTGCG
CTGTTTGTGACGCCGCTGGTGGTGATTTTGGGCTGGATCATCGGGCGAGAGATGTCGCTCTTCTTCACGCTGTTT
GAGACGGTCAGCCTGTTCGCGTCGGCCTTTATCGTCAACTTTCTGGTGCTGGACGGGCGCAGCAACTATCTCGAG
GGGGCGCTGCTGTGCGCCGTCTACGTCATCATTGCCATTGTCGCGTTTTTCTTTCCGAGCGAGCGGGAGACGAGC
ACGTGGGGGAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail