Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1102
Gene name
LocationContig_141:18314..20622
Strand+
Gene length (bp)2308
Transcript length (bp)1968
Coding sequence length (bp)1968
Protein length (aa) 656

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 9.8E-13 57 285

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B093|A1864_ARTBC Secreted protein ARB_01864 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01864 PE=1 SV=1 20 652 0.0E+00
sp|Q9HDU9|YHE6_SCHPO Uncharacterized protein PB2B2.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.06c PE=3 SV=1 49 625 2.0E-139
sp|Q9US39|YFZ2_SCHPO Uncharacterized protein C1039.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.02 PE=3 SV=1 49 625 4.0E-132
sp|O13781|YEO3_SCHPO Uncharacterized protein C17G6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G6.03 PE=3 SV=1 48 494 3.0E-98
sp|P38887|YH02_YEAST Uncharacterized protein YHR202W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR202W PE=1 SV=1 47 621 6.0E-83

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1102
MLTALVALLPTVVACGLGGCYGPLNRVEHVRHVKRMQPGASDAVYGPKRPLEWGQINFLHTTDTHGWLEGHLRER
NYGADWGDFVSFTRRMKHKAYQLGVDLLLVDTGDLHDGTGLSDATAVDGAESMPIFDQIDYDLLAIGNHELYVSE
VAYQMLDQYAHKWGDKYVTSNVQILNRTSGQYQYVGATHRDFTTAQGLRILAFGLLFDFTGNSNASRVIKAEEMV
QKAWFKDVLANSDAVDLFVLLGHNPVRPTNRQSTFKVVIDAIRAVHPKKPIQIFGGHSHIRDFVVYDDASVGLES
GRYCETLGWASMTGFNVSKSSHPGALKPQGVAKACRPARPGSKSPFAYSRRYLDWNRKTFVFHSQRDDKTFDLAS
GRRLTGHISKVRDELRLGDVYGCAPQDWCASCAPFDDETKNIFPGVFYPAAAYAVINQSRADRPRIILGNTGGIR
FDVHKGPFTHDDSLIVSPFRNVFLAISDVRYEEASELLQKLNRGLADKRHIQPVMASLNDDCVDPTLGQLGQMGV
DGGVFRRQESVTPGYVTTDDWGEDGMAVKTMMMNSGLRDTGDDTEHSKIPSFTIPKYWGTRASFPVNGSEPERVD
VVFVDFIKKRVLEHLGEGYGDKVHCYIHCNFTAQDVLGIYAKWAWQANRHDCPVL*
Coding >Ophun1|1102
ATGCTCACGGCTCTCGTCGCTCTGCTTCCTACGGTAGTCGCCTGCGGCCTCGGCGGCTGCTATGGGCCCTTGAAC
CGCGTCGAGCACGTTCGCCACGTGAAGCGCATGCAGCCGGGAGCGTCCGACGCAGTCTACGGCCCCAAGAGACCC
TTGGAATGGGGCCAGATAAACTTCCTTCACACGACTGATACGCATGGCTGGCTCGAGGGCCACCTGAGGGAGCGC
AACTATGGCGCCGACTGGGGTGACTTTGTTTCTTTTACCCGACGGATGAAGCACAAGGCATATCAACTGGGTGTC
GACTTACTGCTCGTCGACACGGGCGATCTCCATGATGGAACTGGCCTCTCAGACGCAACGGCTGTTGACGGCGCT
GAGTCGATGCCAATCTTCGACCAGATCGACTATGACCTGCTCGCAATCGGTAACCACGAACTGTACGTGTCCGAG
GTCGCCTATCAGATGCTGGACCAATACGCCCACAAATGGGGAGACAAGTATGTGACGTCCAATGTTCAGATACTG
AACCGCACGTCGGGTCAGTATCAATACGTAGGCGCCACTCATCGCGACTTTACCACGGCTCAGGGGCTCCGCATC
CTGGCCTTTGGTCTCCTCTTTGACTTTACAGGCAACTCGAATGCCTCCCGCGTTATCAAGGCTGAGGAGATGGTC
CAGAAGGCCTGGTTCAAAGACGTCTTGGCCAACTCGGACGCCGTCGATCTATTTGTTCTCCTGGGACACAATCCC
GTGCGGCCGACCAATCGACAGAGCACCTTTAAAGTCGTCATTGATGCCATCCGCGCAGTGCATCCGAAGAAGCCG
ATTCAGATATTCGGCGGCCACAGCCACATCCGAGACTTTGTCGTATACGACGATGCGTCGGTCGGGCTCGAGTCA
GGCCGTTACTGCGAGACGCTCGGCTGGGCGTCGATGACGGGCTTCAACGTATCCAAAAGCAGTCACCCGGGAGCT
CTCAAACCGCAGGGCGTCGCAAAAGCGTGTCGTCCGGCCAGGCCCGGATCCAAGTCGCCGTTTGCGTACTCTCGC
CGCTATCTGGACTGGAACCGCAAGACTTTCGTGTTCCATTCTCAACGAGACGACAAGACGTTTGACCTCGCCTCG
GGTCGGAGGCTGACGGGTCACATCAGCAAAGTGCGCGACGAGCTGCGGCTGGGCGACGTGTACGGCTGTGCGCCG
CAGGACTGGTGCGCCTCCTGCGCGCCCTTTGACGACGAGACCAAGAACATATTTCCCGGCGTCTTCTATCCCGCC
GCGGCCTACGCTGTCATCAACCAGAGCCGGGCCGACAGACCGCGTATCATCCTAGGAAACACGGGGGGCATCCGC
TTCGACGTGCACAAGGGGCCCTTTACCCATGACGACAGCTTGATCGTGTCTCCCTTCCGCAACGTCTTCTTGGCC
ATTTCGGACGTACGTTATGAAGAGGCCTCGGAGCTGCTGCAGAAGCTCAACCGCGGCTTGGCGGACAAGCGTCAC
ATTCAACCGGTCATGGCTAGTTTAAACGACGATTGCGTCGATCCGACGCTCGGTCAGCTGGGCCAGATGGGTGTC
GACGGAGGCGTGTTTCGTCGACAGGAGTCTGTGACTCCGGGGTACGTGACGACGGACGACTGGGGGGAAGACGGT
ATGGCTGTGAAGACGATGATGATGAACAGCGGCTTACGGGATACAGGAGACGACACGGAGCACTCGAAGATCCCC
AGCTTCACGATCCCCAAGTATTGGGGAACGCGCGCTTCGTTTCCCGTCAACGGCAGCGAGCCGGAGCGGGTGGAC
GTTGTCTTTGTCGACTTCATCAAGAAGCGGGTGCTGGAACATCTCGGAGAGGGCTATGGTGACAAGGTGCACTGC
TATATCCACTGCAACTTTACCGCGCAGGACGTACTTGGAATCTACGCAAAGTGGGCGTGGCAGGCGAATCGCCAT
GACTGTCCGGTGCTGTGA
Transcript >Ophun1|1102
ATGCTCACGGCTCTCGTCGCTCTGCTTCCTACGGTAGTCGCCTGCGGCCTCGGCGGCTGCTATGGGCCCTTGAAC
CGCGTCGAGCACGTTCGCCACGTGAAGCGCATGCAGCCGGGAGCGTCCGACGCAGTCTACGGCCCCAAGAGACCC
TTGGAATGGGGCCAGATAAACTTCCTTCACACGACTGATACGCATGGCTGGCTCGAGGGCCACCTGAGGGAGCGC
AACTATGGCGCCGACTGGGGTGACTTTGTTTCTTTTACCCGACGGATGAAGCACAAGGCATATCAACTGGGTGTC
GACTTACTGCTCGTCGACACGGGCGATCTCCATGATGGAACTGGCCTCTCAGACGCAACGGCTGTTGACGGCGCT
GAGTCGATGCCAATCTTCGACCAGATCGACTATGACCTGCTCGCAATCGGTAACCACGAACTGTACGTGTCCGAG
GTCGCCTATCAGATGCTGGACCAATACGCCCACAAATGGGGAGACAAGTATGTGACGTCCAATGTTCAGATACTG
AACCGCACGTCGGGTCAGTATCAATACGTAGGCGCCACTCATCGCGACTTTACCACGGCTCAGGGGCTCCGCATC
CTGGCCTTTGGTCTCCTCTTTGACTTTACAGGCAACTCGAATGCCTCCCGCGTTATCAAGGCTGAGGAGATGGTC
CAGAAGGCCTGGTTCAAAGACGTCTTGGCCAACTCGGACGCCGTCGATCTATTTGTTCTCCTGGGACACAATCCC
GTGCGGCCGACCAATCGACAGAGCACCTTTAAAGTCGTCATTGATGCCATCCGCGCAGTGCATCCGAAGAAGCCG
ATTCAGATATTCGGCGGCCACAGCCACATCCGAGACTTTGTCGTATACGACGATGCGTCGGTCGGGCTCGAGTCA
GGCCGTTACTGCGAGACGCTCGGCTGGGCGTCGATGACGGGCTTCAACGTATCCAAAAGCAGTCACCCGGGAGCT
CTCAAACCGCAGGGCGTCGCAAAAGCGTGTCGTCCGGCCAGGCCCGGATCCAAGTCGCCGTTTGCGTACTCTCGC
CGCTATCTGGACTGGAACCGCAAGACTTTCGTGTTCCATTCTCAACGAGACGACAAGACGTTTGACCTCGCCTCG
GGTCGGAGGCTGACGGGTCACATCAGCAAAGTGCGCGACGAGCTGCGGCTGGGCGACGTGTACGGCTGTGCGCCG
CAGGACTGGTGCGCCTCCTGCGCGCCCTTTGACGACGAGACCAAGAACATATTTCCCGGCGTCTTCTATCCCGCC
GCGGCCTACGCTGTCATCAACCAGAGCCGGGCCGACAGACCGCGTATCATCCTAGGAAACACGGGGGGCATCCGC
TTCGACGTGCACAAGGGGCCCTTTACCCATGACGACAGCTTGATCGTGTCTCCCTTCCGCAACGTCTTCTTGGCC
ATTTCGGACGTACGTTATGAAGAGGCCTCGGAGCTGCTGCAGAAGCTCAACCGCGGCTTGGCGGACAAGCGTCAC
ATTCAACCGGTCATGGCTAGTTTAAACGACGATTGCGTCGATCCGACGCTCGGTCAGCTGGGCCAGATGGGTGTC
GACGGAGGCGTGTTTCGTCGACAGGAGTCTGTGACTCCGGGGTACGTGACGACGGACGACTGGGGGGAAGACGGT
ATGGCTGTGAAGACGATGATGATGAACAGCGGCTTACGGGATACAGGAGACGACACGGAGCACTCGAAGATCCCC
AGCTTCACGATCCCCAAGTATTGGGGAACGCGCGCTTCGTTTCCCGTCAACGGCAGCGAGCCGGAGCGGGTGGAC
GTTGTCTTTGTCGACTTCATCAAGAAGCGGGTGCTGGAACATCTCGGAGAGGGCTATGGTGACAAGGTGCACTGC
TATATCCACTGCAACTTTACCGCGCAGGACGTACTTGGAATCTACGCAAAGTGGGCGTGGCAGGCGAATCGCCAT
GACTGTCCGGTGCTGTGA
Gene >Ophun1|1102
ATGCTCACGGCTCTCGTCGCTCTGCTTCCTACGGTAGTCGCCTGCGGCCTCGGCGGCTGCTATGGGCCCTTGAAC
CGCGTCGAGCACGTTCGCCACGTGAAGCGCATGCAGCCGGGAGCGTCCGACGCAGTCTACGGCCCCAAGAGACCC
TTGGAATGGGGCCAGATAAACTTCCTTCACACGGTATCGGCGACTCCTCTCGTCTTTCTATACCAAGCTCGAGTT
GACGGCATGTCAGACTGATACGCATGGCTGGCTCGAGGGCCACCTGAGGGAGCGCAACTATGGCGCCGACTGGGG
TGACTTTGTTTCTTTTACCCGACGGATGAAGCACAAGGCATATCAACTGGGTGTCGACTTACTGCTCGTCGACAC
GGGCGATCTCCATGATGGAACTGGCCTCTCAGACGCAACGGCTGTTGACGGCGCTGAGTCGATGCCAATCTTCGA
CCAGATCGACTATGACCTGCTCGCAATCGGTGCGCGCTCACGTCTCCACCTCATTTACTAAAAGCTTGCCGTCTG
ACAGCTGTAGGTAACCACGAACTGTACGTGTCCGAGGTCGCCTATCAGATGCTGGACCAATACGCCCACAAATGG
GGAGACAAGTATGTGACGTCCAATGTTCAGATACTGAACCGCACGTCGGGTCAGTATCAATACGTAGGCGCCACT
CATCGCGACTTTACCACGGCTCAGGGGCTCCGCATCCTGGCCTTTGGTCTCCTCTTTGACTTTACAGGTAGGCTG
TATTGTGGACTTGAAACGTGGTAGATTTACCGCTGAATCCCGGTTCTCAAGGCAACTCGAATGCCTCCCGCGTTA
TCAAGGCTGAGGAGATGGTCCAGAAGGCCTGGTTCAAAGACGTCTTGGCCAACTCGGACGCCGTCGATCTATTTG
TTCTCCTGGGACACAATCCCGTGCGGCCGACCAATCGACAGAGCACCTTTAAAGTCGTCATTGATGCCATCCGCG
CAGTGCATCCGAAGAAGCCGATTCAGATATTCGGCGGCCACAGCCACATCCGAGACTTTGTCGTATACGACGATG
CGTCGGTCGGGCTCGAGTCAGGCCGTTACTGCGAGACGCTCGGCTGGGCGTCGATGACGGGCTTCAACGTATCCA
AAAGCAGTCACCCGGGAGCTCTCAAACCGCAGGGCGTCGCAAAAGCGTGTCGTCCGGCCAGGCCCGGATCCAAGT
CGCCGTTTGCGTACTCTCGCCGCTATCTGGACTGGAACCGCAAGACTTTCGTGTTCCATTCTCAACGAGACGACA
AGACGTTTGACCTCGCCTCGGGTCGGAGGCTGACGGGTCACATCAGCAAAGTGCGCGACGAGCTGCGGCTGGGCG
ACGTGTACGGCTGTGCGCCGCAGGACTGGTGCGCCTCCTGCGCGCCCTTTGACGACGAGACCAAGAACATATTTC
CCGGCGTCTTCTATCCCGCCGCGGCCTACGCTGTCATCAACCAGAGCCGGGCCGACAGACCGCGTATCATCCTAG
GAAACACGGGGGGCATCCGCTTCGACGTGCACAAGGGGCCCTTTACCCATGACGACAGCTTGATCGTGTCTCCCT
TCCGCAACGTCTTCTTGGCCATTTCGGACGTACGTTATGAAGAGGCCTCGGAGCTGCTGCAGAAGTGAGATGATG
GCTCTTCTCATGGGCTGGTCGATGAACTGACTGCGCCCTCAAAAGGCTCAACCGCGGCTTGGCGGACAAGCGTCA
CATTCAACCGGTCATGGCTAGTTTAAACGACGATTGCGTCGATCCGACGCTCGGTCAGCTGGGCCAGATGGGTGT
CGACGGAGGCGTGTTTCGTCGACAGGAGTCTGTGACTCCGGGGTACGTGACGACGGACGACTGGGGGGAAGACGG
TATGGCTGTGAAGACGATGATGATGAACAGCGGCTTACGGGATACAGGAGACGACACGGAGCACTCGAAGATCCC
CAGCTTCACGATCCCCAAGTATTGGGGAACGCGCGCTTCGTTTCCCGTCAACGGCAGCGAGCCGGAGCGGGTGGA
CGTTGTCTTTGTCGACTTGTGCGTGAAAGATACGCCTTGACTGGAAATGGATCACGGCTGACGGTCTGTGACGCA
GCATCAAGAAGCGGGTGCTGGAACATCTCGGAGAGGGCTATGGTGACAAGGTGCACTGCTATATCCACTGCAACT
TTACCGCGCAGGGTCAGTTCCCTCGTCTCCCTTGACTCAGCATCTGTGCTGACGGCATCTCACATCAGACGTACT
TGGAATCTACGCAAAGTGGGCGTGGCAGGCGAATCGCCATGACTGTCCGGTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail