Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|11
Gene name
LocationContig_1:24640..28170
Strand+
Gene length (bp)3530
Transcript length (bp)3201
Coding sequence length (bp)3201
Protein length (aa) 1067

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 7.8E-35 297 437
PF02460 Patched Patched family 4.3E-09 294 430

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 12 439 1.0E-21
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 146 439 9.0E-21
sp|Q12770|SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 146 439 9.0E-20
sp|A2RRU4|SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 148 439 4.0E-18
sp|P97260|SCAP_CRIGR Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus GN=SCAP PE=1 SV=1 146 439 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 12 439 1.0E-21
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 146 439 9.0E-21
sp|Q12770|SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 146 439 9.0E-20
sp|A2RRU4|SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 148 439 4.0E-18
sp|P97260|SCAP_CRIGR Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus GN=SCAP PE=1 SV=1 146 439 5.0E-18
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 146 439 7.0E-18
sp|Q6GQT6|SCAP_MOUSE Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 148 439 7.0E-18
sp|O43043|SCAP_SCHPO Sterol regulatory element-binding protein cleavage-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scp1 PE=1 SV=1 276 712 5.0E-17
sp|P56941|NPC1_PIG Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1 269 436 4.0E-08
sp|O15118|NPC1_HUMAN Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2 269 456 7.0E-08
sp|Q0EEE2|PTHD3_MOUSE Patched domain-containing protein 3 OS=Mus musculus GN=Ptchd3 PE=1 SV=1 262 434 2.0E-07
sp|O35604|NPC1_MOUSE Niemann-Pick C1 protein OS=Mus musculus GN=Npc1 PE=1 SV=2 269 458 3.0E-07
sp|O35595|PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus GN=Ptch2 PE=2 SV=2 225 434 6.0E-06
sp|Q12649|HMDH_PHYB8 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=hmgA PE=3 SV=2 154 439 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 273 290 17
3 305 327 22
4 339 361 22
5 376 398 22
6 405 427 22
7 474 493 19
8 596 618 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|11
MIWYLLYPLRGAFARYGRYAARHVVATLLVSAAVATVLVYPIPFLFTSDFVNGASNLPRHVWTVAQPLAYDTAKE
PDIIMRSIWVHASYMQALDTELLVSALQLQDDLLGITKNFSPASARHTPPWNDLPDHDLSLTQRDAIHVANGLTS
QSWFFHSPLLYWGCSRERILADDDILSTVNNRKNQSTFANVTLRHSIVFSGKRFEERRLLAADSLVITLLHLGDS
PVGRRWERQALELPKKAGDKWNIYPPDGRAASSQLYEFQFRPISMQDIASLALAYGLTLVYFLKTLSNLRAVKSR
VGLMVTVLAQIIFSIMSSFTVCAIFNVDLSRIPRAAYPLVVLAMSLEHIFRLINAVLLTPLEDVVSNRIGKAFAE
TAPTAMFSTLQNVVLLAGLSRLVSAGVSGFCVFAAIAIVFDFFYLSTFFLAVLSVDVRRIELGEALAKASMRHNC
DLRGSRHSWWDPVWQGRIALSTRIAGTIIMFGFVLIAQWHFFGDEGLIRKLVRFYGDSDRGQGPGPSMSSLLDSL
HQARSPTSWLRIQDHETAREVISIIKPLSYSYVARVYDPIVFVLKNSDRVPLRKEPTLLPAAYDFVKHELFRFLV
VVVVVIAALRLLTNFLLWEDEDINGQHEPEELPRMSVKSLARGHLMDVVLLTTSADGHVVSVGLDNTIRAWSVKG
IGTSYVIARGDEPQTFVFPVVAMAIDNDSRWLVIMSRPKRDACSSVSFSFWDLQSRTWGSSIQANNCRHRPVALL
LDPSAPSDQPRALVIQQDVSRQGEVHMATRDNGVWTRRRLAIEGLDETGAHSIQVVAMLNLFVVAGGDRAHLIDG
KDGGVLQTLRTAKMLPRPLRCAYTRHGSSQPESMGLASFTLGYVEADSRDCILQTYVPPEDCDAIYLRTPCEART
YNWCTWESARETRKRVADPGVWEMVSDGSAVGIRFHRPVGKGYQVKAMSGLRNRYGKREAEPDPFEGWQVWMESS
PGCRHEESESHRLIKDGEQAGHLLVTEVGPKARVGLNSVAFAFGDMIKLVIVGPKVRLKERPEGRAGEALMMSAG
GRRRKPASLLRGRVAS*
Coding >Ophun1|11
ATGATCTGGTATCTCTTGTACCCGTTGCGAGGCGCCTTTGCTCGCTATGGCCGCTACGCTGCTCGCCACGTCGTC
GCGACTCTTCTCGTCTCTGCCGCCGTGGCTACCGTTCTCGTATATCCTATCCCTTTCCTCTTCACCAGCGACTTC
GTCAACGGCGCATCCAATTTACCTCGCCACGTCTGGACCGTCGCCCAGCCCCTTGCGTATGACACCGCCAAGGAA
CCAGACATCATTATGCGCTCCATTTGGGTGCATGCCAGCTACATGCAGGCCTTGGATACCGAGCTGTTAGTCTCG
GCTCTTCAACTTCAAGACGACCTGCTTGGCATTACAAAAAACTTTAGCCCTGCGAGTGCCCGGCATACGCCTCCC
TGGAACGACTTACCCGACCACGACCTGTCTCTGACCCAACGAGATGCGATCCATGTTGCCAACGGTCTAACTTCG
CAGTCTTGGTTCTTCCATTCGCCGTTGCTGTACTGGGGTTGCAGTCGAGAGCGCATTCTGGCCGACGACGATATC
CTCTCGACCGTCAATAACAGAAAGAACCAGTCCACATTTGCCAACGTCACTCTCCGCCACTCCATCGTCTTTAGC
GGCAAACGATTCGAGGAACGCCGCTTGCTGGCCGCCGATTCGCTCGTCATCACCCTGTTGCATCTTGGCGACTCT
CCCGTCGGTCGACGATGGGAGAGACAGGCCTTAGAGCTGCCCAAAAAGGCAGGGGATAAATGGAATATATACCCG
CCAGACGGACGAGCCGCATCCAGCCAGCTCTACGAGTTTCAGTTTCGACCCATCTCCATGCAGGACATAGCCAGC
CTCGCCTTGGCCTATGGTCTCACCTTGGTTTACTTCCTCAAAACCCTATCCAACCTGAGGGCTGTCAAATCTAGA
GTCGGTCTCATGGTCACAGTGCTGGCGCAAATCATCTTCTCCATCATGTCCAGCTTCACAGTCTGCGCCATCTTC
AACGTCGACCTCTCCCGCATCCCGCGGGCAGCATACCCCCTAGTAGTCTTGGCCATGAGCCTGGAACACATCTTT
AGGCTCATCAACGCCGTCCTCCTGACGCCCTTGGAGGATGTTGTGAGCAACAGAATCGGCAAAGCTTTCGCCGAG
ACCGCCCCGACTGCCATGTTCAGCACCCTGCAAAACGTCGTTCTTCTTGCGGGCCTCTCCCGTCTGGTGTCTGCA
GGGGTGTCGGGCTTCTGCGTATTCGCCGCCATTGCCATCGTCTTCGACTTCTTCTATCTCAGCACCTTCTTCTTG
GCCGTCTTGAGCGTCGACGTCCGTCGGATAGAGCTCGGCGAGGCACTGGCCAAAGCCTCGATGCGACACAACTGT
GACTTGCGTGGCAGCCGCCACTCTTGGTGGGACCCGGTCTGGCAAGGGAGGATCGCCTTGTCGACCCGCATTGCG
GGCACAATCATCATGTTCGGCTTCGTTCTCATCGCCCAGTGGCACTTCTTTGGTGACGAGGGCTTGATCCGTAAA
CTCGTGCGGTTCTACGGGGACTCTGACCGAGGCCAGGGTCCAGGCCCTTCCATGTCGTCCTTGCTCGATAGTCTC
CACCAGGCGAGGAGCCCTACATCTTGGCTGCGCATACAGGATCACGAGACAGCCCGTGAGGTGATCAGTATCATC
AAACCGTTGTCATACAGCTACGTGGCCCGCGTCTACGATCCGATCGTCTTCGTCTTGAAGAACTCGGATCGTGTG
CCACTGAGAAAAGAACCTACCCTGCTACCGGCAGCTTACGATTTCGTCAAACACGAGTTATTTCGCTTTCTTGTC
GTCGTCGTCGTCGTGATTGCGGCTCTCCGCCTGTTGACCAATTTCCTCCTGTGGGAGGATGAGGATATCAATGGC
CAGCACGAGCCGGAAGAGCTTCCGCGGATGTCCGTCAAGTCCTTGGCCAGAGGCCATCTGATGGACGTCGTGTTA
CTGACAACGTCGGCGGATGGCCATGTCGTGTCCGTCGGGCTCGATAACACGATCCGAGCGTGGTCGGTAAAGGGC
ATCGGAACGAGCTACGTGATCGCAAGAGGCGATGAACCCCAGACTTTCGTGTTCCCCGTGGTGGCAATGGCCATT
GACAACGACTCAAGATGGCTCGTCATCATGTCGAGGCCTAAGCGAGATGCCTGCTCCAGTGTCAGCTTCAGCTTC
TGGGACCTGCAGAGCAGAACATGGGGCTCGTCGATCCAGGCCAACAACTGTCGACACAGACCGGTGGCTCTCCTA
CTCGACCCCAGCGCGCCTAGTGATCAGCCGAGGGCGCTCGTTATCCAGCAGGACGTATCGAGGCAGGGTGAGGTC
CACATGGCGACTCGAGACAATGGCGTCTGGACACGTCGACGACTCGCGATCGAGGGCCTGGATGAGACGGGCGCT
CATTCCATTCAGGTCGTAGCTATGTTGAATCTATTTGTGGTGGCAGGAGGTGACCGTGCCCATCTCATCGATGGC
AAAGATGGAGGCGTGTTGCAGACGCTGCGTACGGCCAAGATGCTGCCACGGCCTTTGAGGTGTGCATACACGCGC
CACGGCTCTTCACAGCCCGAGTCGATGGGCCTCGCGTCCTTCACTCTCGGCTACGTGGAAGCCGATTCCCGGGAT
TGCATTTTGCAGACTTATGTGCCGCCGGAAGATTGTGATGCCATTTACTTGCGGACGCCGTGCGAGGCTCGAACT
TACAACTGGTGCACGTGGGAGTCGGCAAGGGAGACGCGGAAGCGCGTAGCGGACCCCGGTGTGTGGGAGATGGTT
TCTGACGGCAGCGCAGTGGGCATACGGTTTCACCGTCCCGTCGGCAAGGGATATCAGGTCAAGGCCATGTCGGGT
TTGCGGAACCGATACGGCAAAAGGGAAGCGGAGCCAGACCCGTTTGAGGGCTGGCAGGTGTGGATGGAGTCGTCA
CCGGGCTGTCGGCATGAAGAGAGCGAAAGCCATCGTCTAATCAAGGACGGCGAGCAGGCTGGGCATCTGCTGGTG
ACGGAGGTGGGGCCGAAAGCCAGAGTCGGGCTGAACTCGGTCGCGTTTGCATTTGGCGACATGATCAAGCTCGTG
ATTGTCGGGCCCAAAGTGCGGCTCAAGGAGAGGCCCGAGGGCCGGGCGGGCGAGGCCTTGATGATGAGCGCCGGG
GGCAGACGGCGGAAGCCAGCATCGCTCTTGAGGGGGCGAGTCGCGTCTTGA
Transcript >Ophun1|11
ATGATCTGGTATCTCTTGTACCCGTTGCGAGGCGCCTTTGCTCGCTATGGCCGCTACGCTGCTCGCCACGTCGTC
GCGACTCTTCTCGTCTCTGCCGCCGTGGCTACCGTTCTCGTATATCCTATCCCTTTCCTCTTCACCAGCGACTTC
GTCAACGGCGCATCCAATTTACCTCGCCACGTCTGGACCGTCGCCCAGCCCCTTGCGTATGACACCGCCAAGGAA
CCAGACATCATTATGCGCTCCATTTGGGTGCATGCCAGCTACATGCAGGCCTTGGATACCGAGCTGTTAGTCTCG
GCTCTTCAACTTCAAGACGACCTGCTTGGCATTACAAAAAACTTTAGCCCTGCGAGTGCCCGGCATACGCCTCCC
TGGAACGACTTACCCGACCACGACCTGTCTCTGACCCAACGAGATGCGATCCATGTTGCCAACGGTCTAACTTCG
CAGTCTTGGTTCTTCCATTCGCCGTTGCTGTACTGGGGTTGCAGTCGAGAGCGCATTCTGGCCGACGACGATATC
CTCTCGACCGTCAATAACAGAAAGAACCAGTCCACATTTGCCAACGTCACTCTCCGCCACTCCATCGTCTTTAGC
GGCAAACGATTCGAGGAACGCCGCTTGCTGGCCGCCGATTCGCTCGTCATCACCCTGTTGCATCTTGGCGACTCT
CCCGTCGGTCGACGATGGGAGAGACAGGCCTTAGAGCTGCCCAAAAAGGCAGGGGATAAATGGAATATATACCCG
CCAGACGGACGAGCCGCATCCAGCCAGCTCTACGAGTTTCAGTTTCGACCCATCTCCATGCAGGACATAGCCAGC
CTCGCCTTGGCCTATGGTCTCACCTTGGTTTACTTCCTCAAAACCCTATCCAACCTGAGGGCTGTCAAATCTAGA
GTCGGTCTCATGGTCACAGTGCTGGCGCAAATCATCTTCTCCATCATGTCCAGCTTCACAGTCTGCGCCATCTTC
AACGTCGACCTCTCCCGCATCCCGCGGGCAGCATACCCCCTAGTAGTCTTGGCCATGAGCCTGGAACACATCTTT
AGGCTCATCAACGCCGTCCTCCTGACGCCCTTGGAGGATGTTGTGAGCAACAGAATCGGCAAAGCTTTCGCCGAG
ACCGCCCCGACTGCCATGTTCAGCACCCTGCAAAACGTCGTTCTTCTTGCGGGCCTCTCCCGTCTGGTGTCTGCA
GGGGTGTCGGGCTTCTGCGTATTCGCCGCCATTGCCATCGTCTTCGACTTCTTCTATCTCAGCACCTTCTTCTTG
GCCGTCTTGAGCGTCGACGTCCGTCGGATAGAGCTCGGCGAGGCACTGGCCAAAGCCTCGATGCGACACAACTGT
GACTTGCGTGGCAGCCGCCACTCTTGGTGGGACCCGGTCTGGCAAGGGAGGATCGCCTTGTCGACCCGCATTGCG
GGCACAATCATCATGTTCGGCTTCGTTCTCATCGCCCAGTGGCACTTCTTTGGTGACGAGGGCTTGATCCGTAAA
CTCGTGCGGTTCTACGGGGACTCTGACCGAGGCCAGGGTCCAGGCCCTTCCATGTCGTCCTTGCTCGATAGTCTC
CACCAGGCGAGGAGCCCTACATCTTGGCTGCGCATACAGGATCACGAGACAGCCCGTGAGGTGATCAGTATCATC
AAACCGTTGTCATACAGCTACGTGGCCCGCGTCTACGATCCGATCGTCTTCGTCTTGAAGAACTCGGATCGTGTG
CCACTGAGAAAAGAACCTACCCTGCTACCGGCAGCTTACGATTTCGTCAAACACGAGTTATTTCGCTTTCTTGTC
GTCGTCGTCGTCGTGATTGCGGCTCTCCGCCTGTTGACCAATTTCCTCCTGTGGGAGGATGAGGATATCAATGGC
CAGCACGAGCCGGAAGAGCTTCCGCGGATGTCCGTCAAGTCCTTGGCCAGAGGCCATCTGATGGACGTCGTGTTA
CTGACAACGTCGGCGGATGGCCATGTCGTGTCCGTCGGGCTCGATAACACGATCCGAGCGTGGTCGGTAAAGGGC
ATCGGAACGAGCTACGTGATCGCAAGAGGCGATGAACCCCAGACTTTCGTGTTCCCCGTGGTGGCAATGGCCATT
GACAACGACTCAAGATGGCTCGTCATCATGTCGAGGCCTAAGCGAGATGCCTGCTCCAGTGTCAGCTTCAGCTTC
TGGGACCTGCAGAGCAGAACATGGGGCTCGTCGATCCAGGCCAACAACTGTCGACACAGACCGGTGGCTCTCCTA
CTCGACCCCAGCGCGCCTAGTGATCAGCCGAGGGCGCTCGTTATCCAGCAGGACGTATCGAGGCAGGGTGAGGTC
CACATGGCGACTCGAGACAATGGCGTCTGGACACGTCGACGACTCGCGATCGAGGGCCTGGATGAGACGGGCGCT
CATTCCATTCAGGTCGTAGCTATGTTGAATCTATTTGTGGTGGCAGGAGGTGACCGTGCCCATCTCATCGATGGC
AAAGATGGAGGCGTGTTGCAGACGCTGCGTACGGCCAAGATGCTGCCACGGCCTTTGAGGTGTGCATACACGCGC
CACGGCTCTTCACAGCCCGAGTCGATGGGCCTCGCGTCCTTCACTCTCGGCTACGTGGAAGCCGATTCCCGGGAT
TGCATTTTGCAGACTTATGTGCCGCCGGAAGATTGTGATGCCATTTACTTGCGGACGCCGTGCGAGGCTCGAACT
TACAACTGGTGCACGTGGGAGTCGGCAAGGGAGACGCGGAAGCGCGTAGCGGACCCCGGTGTGTGGGAGATGGTT
TCTGACGGCAGCGCAGTGGGCATACGGTTTCACCGTCCCGTCGGCAAGGGATATCAGGTCAAGGCCATGTCGGGT
TTGCGGAACCGATACGGCAAAAGGGAAGCGGAGCCAGACCCGTTTGAGGGCTGGCAGGTGTGGATGGAGTCGTCA
CCGGGCTGTCGGCATGAAGAGAGCGAAAGCCATCGTCTAATCAAGGACGGCGAGCAGGCTGGGCATCTGCTGGTG
ACGGAGGTGGGGCCGAAAGCCAGAGTCGGGCTGAACTCGGTCGCGTTTGCATTTGGCGACATGATCAAGCTCGTG
ATTGTCGGGCCCAAAGTGCGGCTCAAGGAGAGGCCCGAGGGCCGGGCGGGCGAGGCCTTGATGATGAGCGCCGGG
GGCAGACGGCGGAAGCCAGCATCGCTCTTGAGGGGGCGAGTCGCGTCTTGA
Gene >Ophun1|11
ATGATCTGGTATCTCTTGTACCCGTTGCGAGGGTAAGAAATGGTCCCGTCTTCTCACCTCAGGCTTGGGCTGACT
TCCTTCTTCTTCCGTCTCTAGAACCACGGAGGCGCCTGTGCTTCCCGCCTCACATCCTCTTCACAGCGCCTTTGC
TCGCTATGGCCGCTACGCTGCTCGCCACGTCGTCGCGACTCTTCTCGTCTCTGCCGCCGTGGCTACCGTTCTCGT
ATATCCTATCCCTTTCCTCTTCACCAGCGACTTCGTCAACGGCGCATCCAATTTACCTCGCCACGTCTGGACCGT
CGCCCAGCCCCTTGCGTATGACACCGCCAAGGAACCAGACATCATTATGCGCTCCATTTGGGTGCATGCCAGCTA
CATGCAGGCCTTGGATACCGAGCTGTTAGTCTCGGCTCTTCAACTTCAAGACGACCTGCTTGGCATTACAAAAAA
CTTTAGCCCTGCGAGTGCCCGGCATACGCCTCCCTGGAACGACTTACCCGACCACGACCTGTCTCTGACCCAACG
AGATGCGATCCATGTTGCCAACGGTCTAACTTCGCAGTCTTGGTTCTTCCATTCGCCGTTGCTGTACTGGGGTTG
CAGTCGAGAGCGCATTCTGGCCGACGACGATATCCTCTCGACCGTCAATAACAGAAAGAACCAGTCCACATTTGC
CAACGTCACTCTCCGCCACTCCATCGTCTTTAGCGGCAAACGATTCGAGGAACGCCGCTTGCTGGCCGCCGATTC
GCTCGTCATCACCCTGTTGCATCTTGGCGACTCTCCCGTCGGTCGACGATGGGAGAGACAGGCCTTAGAGCTGCC
CAAAAAGGCAGGGGATAAATGGAATATATACCCGCCAGACGGACGAGCCGCATCCAGCCAGCTCTACGAGTTTCA
GTTTCGACCCATCTCCATGCAGGACATAGCCAGCCTCGCCTTGGCCTATGGTCTCACCTTGGTTTACTTCCTCAA
AACCCTATCCAACCTGAGGGCTGTCAAATCTAGAGTCGGTCTCATGGTCACAGTGCTGGCGCAAATCATCTTCTC
CATCATGTCCAGCTTCACAGTCTGCGCCATCTTCAACGTCGACCTCTCCCGCATCCCGCGGGCAGCATACCCCCT
AGTAGTCTTGGCCATGAGCCTGGAACACATCTTTAGGCTCATCAACGCCGTCCTCCTGACGCCCTTGGAGGATGT
TGTGAGCAACAGAATCGGCAAAGCTTTCGCCGAGACCGCCCCGACTGCCATGTTCAGCACCCTGCAAAACGTCGT
TCTTCTTGCGGGCCTCTCCCGTCTGGTGTCTGCAGGGGTGTCGGGCTTCTGCGTATTCGCCGCCATTGCCATCGT
CTTCGACTTCTTCTATCTCAGCACCTTCTTCTTGGCCGTCTTGAGCGTCGACGTCCGTCGGATAGAGCTCGGCGA
GGCACTGGCCAAAGCCTCGATGCGACACAACTGTGACTTGCGTGGCAGCCGCCACTCTTGGTGGGACCCGGTCTG
GCAAGGGAGGATCGCCTTGTCGACCCGCATTGCGGGCACAATCATCATGTTCGGCTTCGTTCTCATCGCCCAGTG
GCACTTCTTTGGTGACGAGGGCTTGATCCGTAAACTCGTGCGGTTCTACGGGGACTCTGACCGAGGCCAGGGTCC
AGGCCCTTCCATGTCGTCCTTGCTCGATAGTCTCCACCAGGCGAGGAGCCCTACATCTTGGCTGCGCATACAGGA
TCACGAGACAGCCCGTGAGGTGATCAGTATCATCAAACCGTTGTCATACAGCTACGTGGCCCGCGTCTACGATCC
GATCGTCTTCGTCTTGAAGAACTCGGATCGTGTGCCACTGAGAAAAGAACCTACCCTGCTACCGGCAGCTTACGA
TTTCGTCAAACACGAGTTATTTCGCTTTCTTGTCGTCGTCGTCGTCGTGATTGCGGCTCTCCGCCTGTTGACCAA
TTTCCTCCTGTGGGAGGATGAGGATATCAATGGCCAGCACGAGCCGGAAGAGCTTCCGCGGATGTCCGTCAAGTC
CTTGGCCAGAGGCCATCTGATGGACGTCGTGTTACTGACAACGTCGGCGGATGGCCATGTCGTGTCCGTCGGGCT
CGATAACACGATCCGAGCGTGGTCGGTAAAGGGCATCGGAACGAGCTACGTGATCGCAAGAGGCGATGAACCCCA
GACTTTCGTGTTCCCCGTGGTGGCAATGGCCATTGACAACGACTCAAGATGGCTCGTCATCATGTCGAGGCCTAA
GCGAGATGCCTGCTCCAGTGTCAGCTTCAGCTTCTGGGACCTGCAGAGCAGAACATGGGGCTCGTCGATCCAGGC
CAACAACTGTCGACACAGACCGGTGGCTCTCCTACTCGACCCCAGCGCGCCTAGTGATCAGCCGAGGGCGCTCGT
TATCCAGCAGGACGGTTCGTTGAATGAGATATTGTCAGGCGGCGAGCAGGCGGAGCAACAACCTGTTCCCTTATT
TCCTCGACACCTGACATGTGCTCGATTGCTGGCCAGAAAAGGTAAACCACCCCCAATTAAGCTCTCGGTCATTGT
CGTTGGTCGCAGCAGAGGGCGCTAACAATCATATCATCGCTCTAGAAGGCGGAGATCCCCCCCCGCGGCCGATCA
TCTTGGCAGTATCGAGGCAGGGTGAGGTCCACATGGCGACTCGAGACAATGGCGTCTGGACACGTCGACGACTCG
CGATCGAGGGCCTGGATGAGACGGGCGCTCATTCCATTCAGGTCGTAGCTATGTTGAATCTATTTGTGGTGGCAG
GAGGTGACCGTGCCCATCTCATCGATGGCAAAGATGGAGGCGTGTTGCAGACGCTGCGTACGGCCAAGATGCTGC
CACGGCCTTTGAGGTGTGCATACACGCGCCACGGCTCTTCACAGCCCGAGTCGATGGGCCTCGCGTCCTTCACTC
TCGGCTACGTGGAAGCCGATTCCCGGGATTGCATTTTGCAGACTTATGTGCCGCCGGAAGATTGTGATGCCATTT
ACTTGCGGACGCCGTGCGAGGCTCGAACTTACAACTGGTGCACGTGGGAGTCGGCAAGGGAGACGCGGAAGCGCG
TAGCGGACCCCGGTGTGTGGGAGATGGTTTCTGACGGCAGCGCAGTGGGCATACGGTTTCACCGTCCCGTCGGCA
AGGGATATCAGGTCAAGGCCATGTCGGGTTTGCGGAACCGATACGGCAAAAGGGAAGCGGAGCCAGACCCGTTTG
AGGGCTGGCAGGTGTGGATGGAGTCGTCACCGGGCTGTCGGCATGAAGAGAGCGAAAGCCATCGTCTAATCAAGG
ACGGCGAGCAGGCTGGGCATCTGCTGGTGACGGAGGTGGGGCCGAAAGCCAGAGTCGGGCTGAACTCGGTCGCGT
TTGCATTTGGCGACATGATCAAGCTCGTGATTGTCGGGCCCAAAGTGCGGCTCAAGGAGAGGCCCGAGGGCCGGG
CGGGCGAGGCCTTGATGATGAGCGCCGGGGGCAGACGGCGGAAGCCAGCATCGCTCTTGAGGGGGCGAGTCGCGT
CTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail