Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1098
Gene name
LocationContig_141:10615..11001
Strand+
Gene length (bp)386
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09784 L31 Mitochondrial ribosomal protein L31 4.8E-46 10 110

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UR27|RM31_SCHPO 54S ribosomal protein L31, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl31 PE=3 SV=1 1 110 1.0E-32
sp|P14063|RM31_YEAST 54S ribosomal protein L31, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL31 PE=1 SV=1 1 107 6.0E-28

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1098
MLGPFRITNPLSGGLLWKIPWRLSKFQKRRHRQRLRAVDEVVATVNAAMAAKGQTVEALERWNAEMPTEAEMLPR
DKYTIFDRKARRYRKGIHKLPKWTRVSQRVNPPGY*
Coding >Ophun1|1098
ATGCTGGGCCCCTTCCGCATAACGAATCCACTCTCGGGAGGTCTTCTCTGGAAGATCCCCTGGCGACTATCCAAG
TTCCAGAAGCGGCGACACCGACAGCGTCTGCGGGCTGTCGACGAGGTTGTCGCCACCGTCAACGCCGCCATGGCG
GCCAAGGGCCAGACTGTCGAGGCTCTGGAGCGGTGGAATGCGGAGATGCCGACTGAGGCGGAGATGCTGCCTCGC
GACAAGTATACCATCTTCGACCGGAAGGCGAGGCGGTATCGGAAGGGGATTCATAAGCTGCCGAAGTGGACGAGG
GTTTCGCAGAGGGTCAATCCGCCGGGGTACTGA
Transcript >Ophun1|1098
ATGCTGGGCCCCTTCCGCATAACGAATCCACTCTCGGGAGGTCTTCTCTGGAAGATCCCCTGGCGACTATCCAAG
TTCCAGAAGCGGCGACACCGACAGCGTCTGCGGGCTGTCGACGAGGTTGTCGCCACCGTCAACGCCGCCATGGCG
GCCAAGGGCCAGACTGTCGAGGCTCTGGAGCGGTGGAATGCGGAGATGCCGACTGAGGCGGAGATGCTGCCTCGC
GACAAGTATACCATCTTCGACCGGAAGGCGAGGCGGTATCGGAAGGGGATTCATAAGCTGCCGAAGTGGACGAGG
GTTTCGCAGAGGGTCAATCCGCCGGGGTACTGA
Gene >Ophun1|1098
ATGCTGGGCCCCTTCCGCATAACGAATCCACTCTCGGGAGGTCTTCTCTGGAAGATCCCCTGGCGACTATCCAAG
TTCCAGAAGCGGCGACACCGACAGCGTCTGCGGGCTGTCGACGAGGTTGTCGCCACCGTCAACGCCGCCATGGCG
GCCAAGGGCCAGACTGTCGAGGCTCTGGAGCGGTGGAATGCGGAGATGCCGACTGAGGCGGAGATGCTGCCTCGC
GACAAGTATACCATCTTCGACCGGAAGGCGAGGCGGTATCGGAAGGGGATTCATAGTGAGACTGTTGTTTACTTT
GGGGTTGATGATGGGCTAATGCTTGGGTGGTAGAGCTGCCGAAGTGGACGAGGGTTTCGCAGAGGGTCAATCCGC
CGGGGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail