Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1094
Gene name
LocationContig_141:4005..4488
Strand-
Gene length (bp)483
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05620 TMEM208_SND2 SRP-independent targeting protein 2/TMEM208 1.1E-49 1 155

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14193|MUG69_SCHPO Meiotically up-regulated gene 69 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug69 PE=1 SV=4 1 128 3.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 86 108 22
3 112 134 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1094
MAQKAKKDLAKSNSAALNRLHLISLVANGIFLVAHLAGRRRSLLTYALLSLPAFACQYILEISGRPKFDAVSGAL
KSPGQDLAAQGLTEYMFDVVWVTWVCCAAVVLAGNWAWLLWAVIPAYAIYLGAGLFGAGRQQLAGMQAAQGGGAP
PANRRARRAA*
Coding >Ophun1|1094
ATGGCACAGAAAGCTAAAAAGGACCTCGCCAAGAGCAATTCCGCCGCTCTCAACCGTCTGCATCTGATCTCCCTC
GTCGCCAACGGCATCTTCCTCGTCGCTCACCTCGCTGGCCGCCGCCGCTCCCTGCTCACCTACGCCCTTCTGTCG
CTACCGGCCTTTGCGTGCCAGTACATCCTCGAGATCTCGGGCCGTCCCAAGTTCGATGCCGTCTCGGGCGCCCTC
AAGAGCCCCGGTCAGGACCTGGCCGCTCAGGGCTTGACCGAGTACATGTTCGATGTCGTCTGGGTCACTTGGGTT
TGCTGCGCTGCTGTCGTTCTGGCCGGCAACTGGGCCTGGCTCTTGTGGGCTGTCATTCCTGCCTATGCTATCTAT
CTCGGAGCTGGTCTCTTCGGCGCCGGCCGTCAGCAGCTCGCCGGCATGCAGGCCGCTCAGGGAGGGGGAGCTCCT
CCGGCCAACCGCCGAGCCAGGCGAGCTGCTTGA
Transcript >Ophun1|1094
ATGGCACAGAAAGCTAAAAAGGACCTCGCCAAGAGCAATTCCGCCGCTCTCAACCGTCTGCATCTGATCTCCCTC
GTCGCCAACGGCATCTTCCTCGTCGCTCACCTCGCTGGCCGCCGCCGCTCCCTGCTCACCTACGCCCTTCTGTCG
CTACCGGCCTTTGCGTGCCAGTACATCCTCGAGATCTCGGGCCGTCCCAAGTTCGATGCCGTCTCGGGCGCCCTC
AAGAGCCCCGGTCAGGACCTGGCCGCTCAGGGCTTGACCGAGTACATGTTCGATGTCGTCTGGGTCACTTGGGTT
TGCTGCGCTGCTGTCGTTCTGGCCGGCAACTGGGCCTGGCTCTTGTGGGCTGTCATTCCTGCCTATGCTATCTAT
CTCGGAGCTGGTCTCTTCGGCGCCGGCCGTCAGCAGCTCGCCGGCATGCAGGCCGCTCAGGGAGGGGGAGCTCCT
CCGGCCAACCGCCGAGCCAGGCGAGCTGCTTGA
Gene >Ophun1|1094
ATGGCACAGAAAGCTAAAAAGGACCTCGCCAAGAGCAATTCCGCCGCTCTCAACCGTCTGCATCTGATCTCCCTC
GTCGCCAACGGCATCTTCCTCGTCGCTCACCTCGCTGGCCGCCGCCGCTCCCTGCTCACCTACGCCCTTCTGTCG
CTACCGGCCTTTGCGTGCCAGTACATCCTCGAGATCTCGGGCCGTCCCAAGTTCGATGCCGTCTCGGGCGCCCTC
AAGAGCCCCGGTCAGGACCTGGCCGCTCAGGGCTTGACCGAGTACATGTTCGATGTCGTCTGGGTCACTTGGGTT
TGCTGCGCTGCTGTCGTTCTGGCCGGCAACTGGGCCTGGCTCTTGTGGGCTGTCATTCCTGCCTATGCTATCTAT
CTCGGAGCTGGTCTCTTCGGCGCCGGCCGTCAGCAGCTCGCCGGCATGCAGGCCGCTCAGGGAGGGGGAGCTCCT
CCGGCCAACCGCCGAGCCAGGCGAGCTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail