Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1093
Gene name
LocationContig_141:3286..3944
Strand+
Gene length (bp)658
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12239 DUF3605 Protein of unknown function (DUF3605) 9.4E-57 34 189

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q59VM7|GIG1_CANAL N-acetylglucosamine-induced protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIG1 PE=2 SV=1 32 201 3.0E-22
sp|Q02754|YP067_YEAST Uncharacterized protein YPL067C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL067C PE=1 SV=1 18 188 1.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1093
MTRPETTTDGLPFALTAVDRELLSQKDDDFKPHSWTELESIIETNDLSALKRKPSDLSRYIKWTADMKKQYGSIT
AFILANRLPGTWGQPPLSPRSQIPLDDAADYKVLLNDWPYGLEAGISHLVVWSRTPIPTDPETGDVTSKSRALIQ
DFVDRRFVNSLGPGRVLWFKNWVTLQSVRSLEHFHVLVRGADEDLLAQWVG*
Coding >Ophun1|1093
ATGACTAGACCGGAGACGACGACAGATGGGCTTCCCTTTGCCTTGACGGCCGTCGACAGAGAGCTGCTGTCGCAG
AAGGACGACGATTTCAAGCCGCATAGTTGGACAGAGTTGGAGAGTATCATCGAGACAAACGACCTCTCAGCCCTC
AAACGAAAGCCGTCTGACCTCAGCCGATATATCAAGTGGACGGCGGATATGAAGAAGCAGTATGGCTCCATCACG
GCCTTTATTCTAGCCAACCGACTGCCGGGAACCTGGGGCCAACCTCCCCTTTCCCCTCGATCCCAGATTCCCCTG
GACGACGCCGCCGACTACAAGGTCCTCCTCAACGACTGGCCGTACGGGCTCGAGGCAGGTATCTCGCACCTGGTC
GTGTGGTCGCGGACTCCAATACCAACAGACCCCGAAACCGGAGACGTGACGTCGAAGAGCCGGGCCCTGATCCAA
GACTTTGTCGACAGGCGCTTCGTGAATTCGCTAGGGCCGGGCCGGGTGCTGTGGTTCAAGAACTGGGTCACACTG
CAGAGCGTGCGGTCGCTGGAGCACTTCCACGTCTTGGTGCGCGGTGCGGACGAGGATCTGCTGGCGCAATGGGTC
GGATAG
Transcript >Ophun1|1093
ATGACTAGACCGGAGACGACGACAGATGGGCTTCCCTTTGCCTTGACGGCCGTCGACAGAGAGCTGCTGTCGCAG
AAGGACGACGATTTCAAGCCGCATAGTTGGACAGAGTTGGAGAGTATCATCGAGACAAACGACCTCTCAGCCCTC
AAACGAAAGCCGTCTGACCTCAGCCGATATATCAAGTGGACGGCGGATATGAAGAAGCAGTATGGCTCCATCACG
GCCTTTATTCTAGCCAACCGACTGCCGGGAACCTGGGGCCAACCTCCCCTTTCCCCTCGATCCCAGATTCCCCTG
GACGACGCCGCCGACTACAAGGTCCTCCTCAACGACTGGCCGTACGGGCTCGAGGCAGGTATCTCGCACCTGGTC
GTGTGGTCGCGGACTCCAATACCAACAGACCCCGAAACCGGAGACGTGACGTCGAAGAGCCGGGCCCTGATCCAA
GACTTTGTCGACAGGCGCTTCGTGAATTCGCTAGGGCCGGGCCGGGTGCTGTGGTTCAAGAACTGGGTCACACTG
CAGAGCGTGCGGTCGCTGGAGCACTTCCACGTCTTGGTGCGCGGTGCGGACGAGGATCTGCTGGCGCAATGGGTC
GGATAG
Gene >Ophun1|1093
ATGACTAGACCGGAGACGACGACAGATGGGCTTCCCTTTGCCTTGACGGCCGTCGACAGAGAGCTGCTGTCGCAG
AAGGACGACGATTTCAAGCCGCATAGTTGGACAGAGTTGGAGAGTATCATCGGTGAGGAGGCCAGCGTCGTGCCC
AAGCGTCCTTTGCTTACGCCCGGAGCCAGAGACAAACGACCTCTCAGCCCTCAAACGAAAGCCGTCTGACCTCAG
CCGATATATCAAGTGGACGGCGGATATGAAGAAGCAGTATGGCTCCATCACGGCCTTTATTCTAGCCAACCGACT
GCCGGGAACCTGGGGCCAACCTCCCCTTTCCCCTCGATCCCAGATTCCCCTGGACGACGCCGCCGACTACAAGGT
CCTCCTCAACGACTGGCCGTACGGGCTCGAGGCAGGTATCTCGCACCTGGTCGTGTGGTCGCGGACTCCAATACC
AACAGACCCCGAAACCGGAGACGTGACGTCGAAGAGCCGGGCCCTGATCCAAGACTTTGTCGACAGGCGCTTCGT
GAATTCGCTAGGGCCGGGCCGGGTGCTGTGGTTCAAGAACTGGGTCACACTGCAGAGCGTGCGGTCGCTGGAGCA
CTTCCACGTCTTGGTGCGCGGTGCGGACGAGGATCTGCTGGCGCAATGGGTCGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail