Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1091
Gene name
LocationContig_1409:1145..2418
Strand+
Gene length (bp)1273
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 1.8E-08 10 233
PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain 1.4E-05 354 402

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B093|A1864_ARTBC Secreted protein ARB_01864 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01864 PE=1 SV=1 4 407 4.0E-100
sp|Q9HDU9|YHE6_SCHPO Uncharacterized protein PB2B2.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.06c PE=3 SV=1 1 407 3.0E-92
sp|Q9US39|YFZ2_SCHPO Uncharacterized protein C1039.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.02 PE=3 SV=1 1 407 1.0E-91
sp|O13781|YEO3_SCHPO Uncharacterized protein C17G6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G6.03 PE=3 SV=1 2 404 4.0E-82
sp|P38887|YH02_YEAST Uncharacterized protein YHR202W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR202W PE=1 SV=1 1 405 2.0E-79

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0009166 nucleotide catabolic process Yes
GO:0034655 nucleobase-containing compound catabolic process No
GO:0006793 phosphorus metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0044248 cellular catabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009056 catabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:1901292 nucleoside phosphate catabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046434 organophosphate catabolic process No
GO:0003674 molecular_function No
GO:0006753 nucleoside phosphate metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0019439 aromatic compound catabolic process No
GO:0046700 heterocycle catabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0044270 cellular nitrogen compound catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1091
MRDLPWGQLNFLHTTDTHGWLSGHLGEPQYSADWGDYVSFAAHMRSRADEAGSDLLVVDTGDRVEGNGLYDASVP
KGRYELDILAAQHMDIACVGNHELYRRSTVIREHNQTVPRLGDAYIASNVDYIDAKTGEVSPLAPRYRKFKTKKL
GLTVVAFGFLFDFVGNANNSRVTPVADTISQPWFQQAMREKPDVFVVAAHIGVRMPELRTIFTALRKQNWHIPIL
FFGGHAHVRDAVRFDTLSVALASGRYLETIGWMSVDNLRPKDSSSVSSAVTISRKYLDNNLLGMYYHTGLNASTF
PTDAGRRATKDITAARAALKLDDRFGCAPRHLWTDRAPYPGNASVYTWLEEELLPSVVVNASRAHVPRLAFINTG
GIRFDIFKGPFTRDTLMAVSPFDNRFVFIPDA*
Coding >Ophun1|1091
ATGCGAGACCTCCCCTGGGGCCAGCTCAACTTCTTGCACACGACGGACACGCACGGCTGGCTGAGCGGCCATCTC
GGCGAGCCGCAGTACTCGGCTGACTGGGGGGACTATGTCTCTTTCGCGGCCCATATGCGGAGCCGTGCTGACGAG
GCCGGATCCGATCTCCTCGTCGTCGATACGGGGGATCGGGTCGAGGGGAATGGCCTTTACGATGCTTCCGTGCCC
AAGGGTCGGTATGAGCTGGATATCTTGGCTGCCCAGCACATGGACATTGCCTGCGTCGGCAACCACGAGCTCTAC
AGACGAAGCACCGTCATCCGCGAGCACAACCAGACGGTCCCGCGCCTGGGAGACGCATACATAGCTTCCAACGTG
GACTACATCGACGCAAAGACGGGCGAGGTCTCGCCGCTGGCTCCCCGATACCGCAAGTTTAAAACCAAGAAGCTT
GGCCTCACCGTCGTGGCCTTTGGCTTCCTCTTCGATTTCGTCGGCAATGCCAATAACTCGCGCGTCACCCCCGTG
GCCGACACCATCAGCCAGCCTTGGTTTCAGCAGGCTATGCGCGAGAAGCCCGATGTCTTCGTCGTGGCCGCTCAT
ATCGGCGTCCGGATGCCCGAGCTGCGAACCATCTTTACCGCCCTGCGCAAGCAGAATTGGCACATCCCCATCCTG
TTCTTCGGAGGCCACGCCCACGTCCGCGACGCCGTTCGCTTCGACACCCTGTCCGTCGCCCTGGCTTCGGGCCGC
TACCTGGAGACCATCGGCTGGATGTCCGTCGACAATCTCCGGCCCAAGGATTCGTCTTCCGTGTCCTCGGCCGTC
ACCATCTCCCGCAAGTACCTCGATAACAACCTGCTGGGCATGTACTACCACACCGGCCTCAACGCCAGCACCTTT
CCCACCGACGCCGGCCGTCGTGCCACCAAGGACATCACCGCCGCACGCGCGGCCCTCAAGCTTGACGATCGCTTC
GGCTGCGCGCCCCGTCATCTCTGGACGGATCGCGCGCCGTATCCTGGCAACGCCAGCGTCTATACCTGGTTGGAA
GAGGAGCTTCTCCCCTCGGTCGTCGTCAACGCCTCTCGCGCTCATGTCCCGCGTCTGGCCTTTATCAACACGGGC
GGCATCCGCTTCGACATCTTCAAGGGCCCCTTTACGCGCGATACCCTCATGGCAGTCAGCCCCTTTGACAACCGC
TTCGTCTTCATCCCCGACGCATAG
Transcript >Ophun1|1091
ATGCGAGACCTCCCCTGGGGCCAGCTCAACTTCTTGCACACGACGGACACGCACGGCTGGCTGAGCGGCCATCTC
GGCGAGCCGCAGTACTCGGCTGACTGGGGGGACTATGTCTCTTTCGCGGCCCATATGCGGAGCCGTGCTGACGAG
GCCGGATCCGATCTCCTCGTCGTCGATACGGGGGATCGGGTCGAGGGGAATGGCCTTTACGATGCTTCCGTGCCC
AAGGGTCGGTATGAGCTGGATATCTTGGCTGCCCAGCACATGGACATTGCCTGCGTCGGCAACCACGAGCTCTAC
AGACGAAGCACCGTCATCCGCGAGCACAACCAGACGGTCCCGCGCCTGGGAGACGCATACATAGCTTCCAACGTG
GACTACATCGACGCAAAGACGGGCGAGGTCTCGCCGCTGGCTCCCCGATACCGCAAGTTTAAAACCAAGAAGCTT
GGCCTCACCGTCGTGGCCTTTGGCTTCCTCTTCGATTTCGTCGGCAATGCCAATAACTCGCGCGTCACCCCCGTG
GCCGACACCATCAGCCAGCCTTGGTTTCAGCAGGCTATGCGCGAGAAGCCCGATGTCTTCGTCGTGGCCGCTCAT
ATCGGCGTCCGGATGCCCGAGCTGCGAACCATCTTTACCGCCCTGCGCAAGCAGAATTGGCACATCCCCATCCTG
TTCTTCGGAGGCCACGCCCACGTCCGCGACGCCGTTCGCTTCGACACCCTGTCCGTCGCCCTGGCTTCGGGCCGC
TACCTGGAGACCATCGGCTGGATGTCCGTCGACAATCTCCGGCCCAAGGATTCGTCTTCCGTGTCCTCGGCCGTC
ACCATCTCCCGCAAGTACCTCGATAACAACCTGCTGGGCATGTACTACCACACCGGCCTCAACGCCAGCACCTTT
CCCACCGACGCCGGCCGTCGTGCCACCAAGGACATCACCGCCGCACGCGCGGCCCTCAAGCTTGACGATCGCTTC
GGCTGCGCGCCCCGTCATCTCTGGACGGATCGCGCGCCGTATCCTGGCAACGCCAGCGTCTATACCTGGTTGGAA
GAGGAGCTTCTCCCCTCGGTCGTCGTCAACGCCTCTCGCGCTCATGTCCCGCGTCTGGCCTTTATCAACACGGGC
GGCATCCGCTTCGACATCTTCAAGGGCCCCTTTACGCGCGATACCCTCATGGCAGTCAGCCCCTTTGACAACCGC
TTCGTCTTCATCCCCGACGCATAG
Gene >Ophun1|1091
ATGCGAGACCTCCCCTGGGGCCAGCTCAACTTCTTGCACACGACGGACACGCACGGCTGGCTGAGCGGCCATCTC
GGCGAGCCGCAGTACTCGGCTGACTGGGGGGACTATGTCTCTTTCGCGGCCCATATGCGGAGCCGTGCTGACGAG
GCCGGATCCGATCTCCTCGTCGTCGATACGGGGGATCGGGTCGAGGGGAATGGCCTTTACGATGCTTCCGTGCCC
AAGGGTCGGTATGAGCTGGATATCTTGGCTGCCCAGCACATGGACATTGCCTGCGTCGGCAACCACGAGCTCTAC
AGACGAAGCACCGTCATCCGCGAGCACAACCAGACGGTCCCGCGCCTGGGAGACGCATACATAGCTTCCAACGTG
GACTACATCGACGCAAAGACGGGCGAGGTCTCGCCGCTGGCTCCCCGATACCGCAAGTTTAAAACCAAGAAGCTT
GGCCTCACCGTCGTGGCCTTTGGCTTCCTCTTCGATTTCGTCGGCAATGCCAATAACTCGCGCGTCACCCCCGTG
GCCGACACCATCAGCCAGCCTTGGTTTCAGCAGGCTATGCGCGAGAAGCCCGATGTCTTCGTCGTGGCCGCTCAT
ATCGGCGTCCGGATGCCCGAGCTGCGAACCATCTTTACCGCCCTGCGCAAGCAGAATTGGCACATCCCCATCCTG
TTCTTCGGAGGCCACGCCCACGTCCGCGACGCCGTTCGCTTCGACACCCTGTCCGTCGCCCTGGCTTCGGGCCGC
TACCTGGAGACCATCGGCTGGATGTCCGTCGACAATCTCCGGCCCAAGGATTCGTCTTCCGTGTCCTCGGCCGTC
ACCATCTCCCGCAAGTACCTCGATAACAACCTGCTGGGCATGTACTACCACACCGGCCTCAACGCCAGCACCTTT
CCCACCGACGCCGGCCGTCGTGCCACCAAGGACATCACCGCCGCACGCGCGGCCCTCAAGCTTGACGATCGCTTC
GGCTGCGCGCCCCGTCATCTCTGGACGGATCGCGCGCCGTATCCTGGCAACGCCAGCGTCTATACCTGGTTGGAA
GAGGAGCTTCTCCCCTCGGTCGTCGTCAACGCCTCTCGCGCTCATGTCCCGCGTCTGGCCTTTATCAACACGGGC
GGCATCCGCTTCGACATCTTCAAGGGCCCCTTTACGCGCGATACCCTCATGGCAGTCAGCCCCTTTGACAACCGC
TTCGTCTTCATCCCCGACGTCCCCTACCCCATCGCCCAGAAACTGCTCGCCATCCTCAACAGCGGAGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail