Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1090
Gene name
LocationContig_1407:476..2280
Strand+
Gene length (bp)1804
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup754
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1567
Ophiocordyceps australis map64 (Brazil) OphauB2|1332
Ophiocordyceps camponoti-floridani Ophcf2|00459
Ophiocordyceps camponoti-rufipedis Ophun1|1090 (this protein)
Ophiocordyceps kimflemingae Ophio5|1910
Ophiocordyceps subramaniannii Hirsu2|2313
Ophiocordyceps subramaniannii Hirsu2|2314

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1090
MSSLKLKPLLLPQLVQERRKLDGQTSSDLVDMSSAFNSFESDIESPVTPIVSPRGLLQRLSSSSSSSPDLPPPPE
TPSSPTAQLFDKRLLPDVQEDPMERFEDDAMSFSSASSEHFGLYSCLCDTPCQHRSSSEGLSPDDMMADFDLDYD
MGFMSDGDSAADARQPAKKRAADNSSPFAGLTSRIGSRLPTIKRWRSNRRANAAVSSPLTDLSLENVFSRGPSSR
SSSLSASNQQTTPERLSEMPPAPSSSTTVSYFASSEDLSGSSLVDMTPEEQSNLERDRSMATTPLLPPLLTDPLG
KPPQESPLQSPTVAPTPAAATAAAAVPPASSPPPPPAPAGLSSPPSLSTRPSLKSLRQVSTATTVATSDMPLPLP
AILQEQDEWSDRLGHANFTITPLPYELDTLSAETVGRFRDDWDAARVNYTKHLVRTGEHYGQTSKIYALTEAKWA
ETERRWKGFYDDMVRQGSRPALDSGNPSRSHSRGRGRGRSSSSVPVMGRLHSSDDVLADLDWRRMDDCLPSAVPR
MLESLDAQGKFPCRGDEDIVGPMQRAAVMARARSEDAKGHFWRSIADKVGFRK*
Coding >Ophun1|1090
ATGTCGTCGCTGAAGCTCAAGCCGTTACTGCTCCCGCAGCTCGTCCAGGAGCGCCGCAAACTCGACGGCCAGACG
AGTTCCGATCTTGTCGACATGTCGTCCGCCTTCAATTCCTTCGAGTCGGATATCGAGTCGCCCGTTACGCCCATC
GTGTCGCCTCGCGGTCTTTTGCAGCGTCTTTCCAGCAGCTCTTCGTCGTCGCCAGATCTGCCGCCTCCCCCAGAG
ACGCCCTCGTCACCCACCGCCCAGCTCTTCGACAAACGCCTTTTGCCCGACGTCCAAGAAGACCCGATGGAGCGC
TTCGAGGACGACGCCATGTCCTTCTCGTCGGCCTCTTCAGAGCACTTTGGTCTCTACAGCTGTCTGTGCGACACG
CCCTGCCAGCATCGCAGCAGCTCTGAGGGGCTGTCTCCGGACGACATGATGGCCGACTTCGACCTGGATTACGAC
ATGGGCTTCATGAGCGACGGCGATTCGGCCGCTGATGCTCGTCAACCGGCAAAGAAGCGCGCCGCCGACAATAGC
TCACCCTTTGCTGGCTTGACATCGCGCATCGGCTCGCGTCTCCCCACCATCAAGCGCTGGAGGTCAAACAGGCGA
GCCAACGCCGCCGTCTCATCGCCCCTAACCGATCTGAGCCTGGAAAACGTGTTCTCGCGCGGGCCGTCGAGCCGC
TCCTCGTCCCTGTCGGCCTCGAACCAACAGACGACGCCAGAGCGCCTCTCCGAGATGCCCCCGGCCCCATCCAGC
TCCACCACCGTCTCTTACTTCGCCAGCTCCGAAGACCTGAGCGGCTCGTCGCTCGTCGACATGACACCCGAGGAA
CAGTCCAACCTGGAACGCGACCGCTCCATGGCCACGACGCCCCTGTTACCCCCGCTCTTGACGGATCCGTTGGGC
AAGCCGCCTCAGGAGTCGCCCCTCCAGTCCCCGACGGTGGCGCCGACGCCCGCCGCCGCCACCGCCGCCGCCGCC
GTGCCTCCTGCGTCTTCCCCTCCGCCGCCGCCTGCGCCCGCGGGCTTGTCATCGCCGCCATCGCTCAGCACTCGC
CCGTCGCTCAAGTCGCTGCGCCAGGTCTCGACGGCCACCACGGTGGCGACGTCAGACATGCCTCTACCGTTGCCC
GCGATCCTGCAGGAGCAAGACGAATGGTCAGATCGCCTGGGCCACGCAAACTTTACCATCACTCCCCTGCCGTAC
GAGCTCGACACGCTGTCGGCCGAGACGGTTGGCCGCTTCCGCGACGACTGGGACGCGGCGCGCGTCAACTACACC
AAGCACCTGGTTCGCACCGGCGAGCACTACGGCCAGACGAGCAAGATCTACGCCCTGACCGAGGCCAAGTGGGCA
GAGACGGAGCGACGCTGGAAGGGTTTCTACGATGACATGGTCCGCCAGGGCAGCCGGCCGGCTCTCGACTCGGGC
AACCCATCACGCAGTCACAGTCGGGGACGGGGACGGGGTCGCTCCAGCAGCTCCGTGCCCGTCATGGGCCGCCTG
CACTCGAGCGACGACGTGCTGGCCGACCTCGACTGGCGACGCATGGACGACTGCCTCCCCAGCGCCGTGCCGCGC
ATGCTAGAGTCGCTCGACGCCCAGGGCAAGTTTCCCTGTCGGGGCGACGAGGACATCGTCGGGCCCATGCAGCGG
GCGGCCGTCATGGCTCGAGCCCGCAGCGAGGACGCAAAAGGCCACTTCTGGCGGAGCATCGCCGACAAGGTGGGC
TTCCGCAAGTGA
Transcript >Ophun1|1090
ATGTCGTCGCTGAAGCTCAAGCCGTTACTGCTCCCGCAGCTCGTCCAGGAGCGCCGCAAACTCGACGGCCAGACG
AGTTCCGATCTTGTCGACATGTCGTCCGCCTTCAATTCCTTCGAGTCGGATATCGAGTCGCCCGTTACGCCCATC
GTGTCGCCTCGCGGTCTTTTGCAGCGTCTTTCCAGCAGCTCTTCGTCGTCGCCAGATCTGCCGCCTCCCCCAGAG
ACGCCCTCGTCACCCACCGCCCAGCTCTTCGACAAACGCCTTTTGCCCGACGTCCAAGAAGACCCGATGGAGCGC
TTCGAGGACGACGCCATGTCCTTCTCGTCGGCCTCTTCAGAGCACTTTGGTCTCTACAGCTGTCTGTGCGACACG
CCCTGCCAGCATCGCAGCAGCTCTGAGGGGCTGTCTCCGGACGACATGATGGCCGACTTCGACCTGGATTACGAC
ATGGGCTTCATGAGCGACGGCGATTCGGCCGCTGATGCTCGTCAACCGGCAAAGAAGCGCGCCGCCGACAATAGC
TCACCCTTTGCTGGCTTGACATCGCGCATCGGCTCGCGTCTCCCCACCATCAAGCGCTGGAGGTCAAACAGGCGA
GCCAACGCCGCCGTCTCATCGCCCCTAACCGATCTGAGCCTGGAAAACGTGTTCTCGCGCGGGCCGTCGAGCCGC
TCCTCGTCCCTGTCGGCCTCGAACCAACAGACGACGCCAGAGCGCCTCTCCGAGATGCCCCCGGCCCCATCCAGC
TCCACCACCGTCTCTTACTTCGCCAGCTCCGAAGACCTGAGCGGCTCGTCGCTCGTCGACATGACACCCGAGGAA
CAGTCCAACCTGGAACGCGACCGCTCCATGGCCACGACGCCCCTGTTACCCCCGCTCTTGACGGATCCGTTGGGC
AAGCCGCCTCAGGAGTCGCCCCTCCAGTCCCCGACGGTGGCGCCGACGCCCGCCGCCGCCACCGCCGCCGCCGCC
GTGCCTCCTGCGTCTTCCCCTCCGCCGCCGCCTGCGCCCGCGGGCTTGTCATCGCCGCCATCGCTCAGCACTCGC
CCGTCGCTCAAGTCGCTGCGCCAGGTCTCGACGGCCACCACGGTGGCGACGTCAGACATGCCTCTACCGTTGCCC
GCGATCCTGCAGGAGCAAGACGAATGGTCAGATCGCCTGGGCCACGCAAACTTTACCATCACTCCCCTGCCGTAC
GAGCTCGACACGCTGTCGGCCGAGACGGTTGGCCGCTTCCGCGACGACTGGGACGCGGCGCGCGTCAACTACACC
AAGCACCTGGTTCGCACCGGCGAGCACTACGGCCAGACGAGCAAGATCTACGCCCTGACCGAGGCCAAGTGGGCA
GAGACGGAGCGACGCTGGAAGGGTTTCTACGATGACATGGTCCGCCAGGGCAGCCGGCCGGCTCTCGACTCGGGC
AACCCATCACGCAGTCACAGTCGGGGACGGGGACGGGGTCGCTCCAGCAGCTCCGTGCCCGTCATGGGCCGCCTG
CACTCGAGCGACGACGTGCTGGCCGACCTCGACTGGCGACGCATGGACGACTGCCTCCCCAGCGCCGTGCCGCGC
ATGCTAGAGTCGCTCGACGCCCAGGGCAAGTTTCCCTGTCGGGGCGACGAGGACATCGTCGGGCCCATGCAGCGG
GCGGCCGTCATGGCTCGAGCCCGCAGCGAGGACGCAAAAGGCCACTTCTGGCGGAGCATCGCCGACAAGGTGGGC
TTCCGCAAGTGA
Gene >Ophun1|1090
ATGTCGTCGCTGAAGCTCAAGCCGTTACTGCTCCCGCAGCTCGTCCAGGAGCGCCGCAAACTCGACGGCCAGACG
AGTTCCGATCTTGTCGACATGTCGTCCGCCTTCAATTCCTTCGAGTCGGATATCGAGTCGCCCGTTACGCCCATC
GTGTCGCCTCGCGGTCTTTTGCAGCGTCTTTCCAGCAGCTCTTCGTCGTCGCCAGATCTGCCGCCTCCCCCAGAG
ACGCCCTCGTCACCCACCGCCCAGCTCTTCGACAAACGCCTTTTGCCCGACGTCCAAGAAGACCCGATGGAGCGC
TTCGAGGACGACGCCATGTCCTTCTCGTCGGCCTCTTCAGAGCACTTTGGTCTCTACAGCTGTCTGTGTAAGTCG
ACCGCTCAGAACACACCCCTGTTTCGTCTACCTGCTGACAGTGGGGGGAAAAAAAATAGGCGACACGCCCTGCCA
GCATCGCAGCAGCTCTGAGGGGCTGTCTCCGGACGACATGATGGCCGACTTCGACCTGGATTACGACATGGGCTT
CATGAGCGACGGCGATTCGGCCGCTGATGCTCGTCAACCGGCAAAGAAGCGCGCCGCCGACAATAGCTCACCCTT
TGCTGGCTTGACATCGCGCATCGGCTCGCGTCTCCCCACCATCAAGCGCTGGAGGTCAAACAGGCGAGCCAACGC
CGCCGTCTCATCGCCCCTAACCGATCTGAGCCTGGAAAACGTGTTCTCGCGCGGGCCGTCGAGCCGCTCCTCGTC
CCTGTCGGCCTCGAACCAACAGACGACGCCAGAGCGCCTCTCCGAGATGCCCCCGGCCCCATCCAGCTCCACCAC
CGTCTCTTACTTCGCCAGCTCCGAAGACCTGAGCGGCTCGTCGCTCGTCGACATGACACCCGAGGAACAGTCCAA
CCTGGAACGCGACCGCTCCATGGCCACGACGCCCCTGTTACCCCCGCTCTTGACGGATCCGTTGGGCAAGCCGCC
TCAGGAGTCGCCCCTCCAGTCCCCGACGGTGGCGCCGACGCCCGCCGCCGCCACCGCCGCCGCCGCCGTGCCTCC
TGCGTCTTCCCCTCCGCCGCCGCCTGCGCCCGCGGGCTTGTCATCGCCGCCATCGCTCAGCACTCGCCCGTCGCT
CAAGTCGCTGCGCCAGGTCTCGACGGCCACCACGGTGGCGACGTCAGACATGCCTCTACCGTTGCCCGCGATCCT
GCAGGAGCAAGACGAATGGTCAGATCGCCTGGGCCACGCAAACTTTACCATCACTCCCCTGCCGTACGAGCTCGA
CACGCTGTCGGCCGAGACGGTTGGCCGCTTCCGCGACGACTGGGACGCGGCGCGCGTCAACTACACCAAGCACCT
GGTTCGCACCGGCGAGCACTACGGCCAGACGAGCAAGATCTACGCCCTGACCGAGGCCAAGTGGGCAGAGACGGA
GCGACGCTGGAAGGGTTTCTACGATGACATGGTCCGCCAGGGCAGCCGGCCGGCTCTCGACTCGGGCAACCCATC
ACGCAGTCACAGTCGGGGACGGGGACGGGGTCGCTCCAGCAGCTCCGTGCCCGTCATGGGCCGCCTGCACTCGAG
CGACGACGTGCTGGCCGACCTCGACTGGCGACGCATGGACGACTGCCTCCCCAGCGCCGTGCCGCGCATGCTAGA
GTCGCTCGACGCCCAGGGCAAGTTTCCCTGTCGGGGCGACGAGGACATCGTCGGGCCCATGCAGCGGGCGGCCGT
CATGGCTCGAGCCCGCAGCGAGGACGCAAAAGGCCACTTCTGGCGGAGCATCGCCGACAAGGTGGGCTTCCGCAA
GTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail