Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|109
Gene name
LocationContig_1000:463..4547
Strand-
Gene length (bp)4084
Transcript length (bp)3570
Coding sequence length (bp)3570
Protein length (aa) 1190

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 2.8E-80 153 361
PF02436 PYC_OADA Conserved carboxylase domain 5.8E-69 869 1068
PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain 8.1E-39 37 148
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 2.1E-29 377 484
PF00682 HMGL-like HMGL-like 1.4E-25 576 844
PF00364 Biotin_lipoyl Biotin-requiring enzyme 7.3E-19 1120 1186
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 2.9E-10 180 329
PF13533 Biotin_lipoyl_2 Biotin-lipoyl like 1.9E-05 1118 1151
PF02222 ATP-grasp ATP-grasp domain 1.5E-07 176 331
PF02655 ATP-grasp_3 ATP-grasp domain 1.6E-05 190 332

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 4 1189 0.0E+00
sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 4 1189 0.0E+00
sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 4 1189 0.0E+00
sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 19 1188 0.0E+00
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 23 1183 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 4 1189 0.0E+00
sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 4 1189 0.0E+00
sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 4 1189 0.0E+00
sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 19 1188 0.0E+00
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 23 1183 0.0E+00
sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 36 1184 0.0E+00
sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 28 1183 0.0E+00
sp|P78992|PYC_PICPA Pyruvate carboxylase OS=Komagataella pastoris GN=PYC1 PE=3 SV=1 25 1188 0.0E+00
sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 36 1186 0.0E+00
sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 37 1186 0.0E+00
sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 37 1186 0.0E+00
sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 37 1186 0.0E+00
sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 37 1186 0.0E+00
sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 33 1189 0.0E+00
sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 37 486 4.0E-134
sp|Q9KDS9|ACCC_BACHD Biotin carboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=accC PE=3 SV=1 37 485 7.0E-126
sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 37 491 2.0E-125
sp|Q06862|ACCC_NOSS1 Biotin carboxylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=accC PE=3 SV=1 35 485 4.0E-124
sp|D3DJ42|2OCS_HYDTT 2-oxoglutarate carboxylase small subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiB PE=1 SV=1 37 491 4.0E-123
sp|O30019|PYCA_ARCFU Pyruvate carboxylase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pycA PE=3 SV=1 37 506 1.0E-120
sp|P49787|ACCC1_BACSU Biotin carboxylase 1 OS=Bacillus subtilis (strain 168) GN=accC1 PE=3 SV=3 37 494 6.0E-117
sp|O34544|ACCC2_BACSU Biotin carboxylase 2 OS=Bacillus subtilis (strain 168) GN=accC2 PE=3 SV=1 37 483 1.0E-112
sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens GN=MCCC1 PE=1 SV=3 37 483 5.0E-112
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 37 484 3.0E-111
sp|Q5I0C3|MCCA_RAT Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Mccc1 PE=1 SV=1 37 483 1.0E-110
sp|P37798|ACCC_PSEAE Biotin carboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=accC PE=1 SV=1 37 484 3.0E-110
sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 27 485 8.0E-110
sp|O04983|ACCC_ARATH Biotin carboxylase, chloroplastic OS=Arabidopsis thaliana GN=CAC2 PE=1 SV=1 39 483 2.0E-109
sp|B9HBA8|ACCC1_POPTR Biotin carboxylase 1, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_831870 PE=2 SV=1 38 483 3.0E-109
sp|Q54KE6|MCCA_DICDI Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=mccA PE=3 SV=1 23 483 5.0E-108
sp|B9N843|ACCC2_POPTR Biotin carboxylase 2, chloroplastic OS=Populus trichocarpa GN=POPTR_0018s14250g PE=2 SV=2 38 483 6.0E-108
sp|P43873|ACCC_HAEIN Biotin carboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=accC PE=1 SV=1 37 484 4.0E-107
sp|Q99MR8|MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus GN=Mccc1 PE=1 SV=2 37 483 1.0E-106
sp|Q2QMG2|MCCA_ORYSJ Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2 37 484 3.0E-106
sp|P24182|ACCC_ECOLI Biotin carboxylase OS=Escherichia coli (strain K12) GN=accC PE=1 SV=2 37 484 4.0E-104
sp|Q8X9B6|ACCC_ECO57 Biotin carboxylase OS=Escherichia coli O157:H7 GN=accC PE=3 SV=1 37 484 5.0E-104
sp|P9WPQ3|BCCA_MYCTU Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accA1 PE=1 SV=1 40 490 1.0E-102
sp|P9WPQ2|BCCA_MYCTO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accA1 PE=3 SV=1 40 490 1.0E-102
sp|P0A509|BCCA_MYCBO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accA1 PE=3 SV=1 40 490 1.0E-102
sp|P46392|BCCA_MYCLE Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium leprae (strain TN) GN=bccA PE=3 SV=2 30 480 3.0E-102
sp|Q91ZA3|PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus GN=Pcca PE=1 SV=2 39 600 2.0E-101
sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens GN=PCCA PE=1 SV=4 39 600 1.0E-100
sp|Q19842|PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans GN=pcca-1 PE=1 SV=1 36 490 2.0E-100
sp|Q612F5|PCCA_CAEBR Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis briggsae GN=pcca-1 PE=3 SV=1 36 490 6.0E-100
sp|P14882|PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus GN=Pcca PE=1 SV=3 39 545 6.0E-99
sp|O52058|ACCC_ALLVD Biotin carboxylase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=accC PE=3 SV=2 37 484 1.0E-98
sp|P38095|LAMA_EMENI Putative urea carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamA PE=2 SV=2 37 485 6.0E-94
sp|Q58628|PYCB_METJA Pyruvate carboxylase subunit B OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycB PE=1 SV=1 576 1186 1.0E-93
sp|O27179|PYCB_METTH Pyruvate carboxylase subunit B OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycB PE=1 SV=1 572 1186 1.0E-87
sp|P13187|DCOA_KLEPN Oxaloacetate decarboxylase alpha chain OS=Klebsiella pneumoniae GN=oadA PE=3 SV=2 576 1186 2.0E-87
sp|Q8XGX8|DCOA_SALTI Oxaloacetate decarboxylase alpha chain OS=Salmonella typhi GN=oadA1 PE=3 SV=3 576 1186 5.0E-87
sp|Q03030|DCOA_SALTY Oxaloacetate decarboxylase alpha chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=oadA1 PE=3 SV=2 576 1186 8.0E-86
sp|D3DJ41|2OCL_HYDTT 2-oxoglutarate carboxylase large subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiA PE=1 SV=1 572 1186 4.0E-83
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 40 484 1.0E-82
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 37 484 3.0E-81
sp|Q70AC7|5S_PROFR Methylmalonyl-CoA carboxyltransferase 5S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=1 582 1098 6.0E-67
sp|O00763|ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens GN=ACACB PE=1 SV=3 37 484 2.0E-56
sp|Q8S6N5|ACC1_ORYSJ Acetyl-CoA carboxylase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=3 SV=1 37 565 3.0E-55
sp|P11029|ACAC_CHICK Acetyl-CoA carboxylase OS=Gallus gallus GN=ACAC PE=1 SV=1 37 484 5.0E-55
sp|E9Q4Z2|ACACB_MOUSE Acetyl-CoA carboxylase 2 OS=Mus musculus GN=Acacb PE=1 SV=1 37 510 5.0E-55
sp|Q13085|ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens GN=ACACA PE=1 SV=2 37 484 9.0E-55
sp|Q5SWU9|ACACA_MOUSE Acetyl-CoA carboxylase 1 OS=Mus musculus GN=Acaca PE=1 SV=1 37 484 2.0E-54
sp|Q9TTS3|ACACA_BOVIN Acetyl-CoA carboxylase 1 OS=Bos taurus GN=ACACA PE=2 SV=1 37 484 2.0E-54
sp|Q28559|ACACA_SHEEP Acetyl-CoA carboxylase 1 OS=Ovis aries GN=ACACA PE=2 SV=1 37 484 4.0E-54
sp|P78820|ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut6 PE=1 SV=2 37 484 4.0E-54
sp|B3LM95|HFA1_YEAS1 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HFA1 PE=3 SV=2 37 485 9.0E-54
sp|C8ZF72|HFA1_YEAS8 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HFA1 PE=3 SV=2 37 485 1.0E-53
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 37 485 1.0E-53
sp|Q54J08|ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum GN=accA PE=3 SV=1 37 484 1.0E-53
sp|Q00955|ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACC1 PE=1 SV=2 3 485 1.0E-53
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 37 485 2.0E-53
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 37 485 2.0E-53
sp|B9FK36|ACC2_ORYSJ Acetyl-CoA carboxylase 2 OS=Oryza sativa subsp. japonica GN=ACC2 PE=3 SV=2 37 484 2.0E-53
sp|P11497|ACACA_RAT Acetyl-CoA carboxylase 1 OS=Rattus norvegicus GN=Acaca PE=1 SV=1 37 484 2.0E-53
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 37 484 8.0E-52
sp|F4I1L3|ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana GN=ACC2 PE=2 SV=1 37 484 5.0E-51
sp|P14846|CARB_SALTY Carbamoyl-phosphate synthase large chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=carB PE=3 SV=4 103 369 1.0E-16
sp|Q8Z9L7|CARB_SALTI Carbamoyl-phosphate synthase large chain OS=Salmonella typhi GN=carB PE=3 SV=3 103 369 1.0E-16
sp|P00968|CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) GN=carB PE=1 SV=2 103 369 7.0E-16
sp|P63738|CARB_SHIFL Carbamoyl-phosphate synthase large chain OS=Shigella flexneri GN=carB PE=3 SV=2 103 369 8.0E-16
sp|P63737|CARB_ECO57 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O157:H7 GN=carB PE=3 SV=2 103 369 8.0E-16
sp|Q8FLB0|CARB_ECOL6 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=carB PE=3 SV=3 103 369 1.0E-15
sp|Q9KPH9|CARB_VIBCH Carbamoyl-phosphate synthase large chain OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=carB PE=3 SV=1 128 369 1.0E-15
sp|Q87SF3|CARB_VIBPA Carbamoyl-phosphate synthase large chain OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=carB PE=3 SV=1 128 369 2.0E-15
sp|Q8ZIL4|CARB_YERPE Carbamoyl-phosphate synthase large chain OS=Yersinia pestis GN=carB PE=3 SV=3 103 369 5.0E-15
sp|Q7MNU0|CARB_VIBVY Carbamoyl-phosphate synthase large chain OS=Vibrio vulnificus (strain YJ016) GN=carB PE=3 SV=1 128 369 6.0E-15
sp|Q8DEM2|CARB_VIBVU Carbamoyl-phosphate synthase large chain OS=Vibrio vulnificus (strain CMCP6) GN=carB PE=3 SV=1 128 369 6.0E-15
sp|B1I4M8|CARB_DESAP Carbamoyl-phosphate synthase large chain OS=Desulforudis audaxviator (strain MP104C) GN=carB PE=3 SV=1 129 363 8.0E-15
sp|Q97FT3|CARB_CLOAB Carbamoyl-phosphate synthase large chain OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=carB PE=3 SV=1 129 367 4.0E-14
sp|C5C687|CARB_BEUC1 Carbamoyl-phosphate synthase large chain OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=carB PE=3 SV=1 129 362 8.0E-14
sp|Q8U085|CARB_PYRFU Carbamoyl-phosphate synthase large chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=carB PE=3 SV=1 133 374 9.0E-14
sp|C1A4I5|CARB_GEMAT Carbamoyl-phosphate synthase large chain OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=carB PE=3 SV=1 128 369 9.0E-14
sp|P58939|CARB_CORGL Carbamoyl-phosphate synthase large chain OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=carB PE=3 SV=1 129 362 1.0E-13
sp|Q9A4D6|CARB_CAUCR Carbamoyl-phosphate synthase large chain OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=carB PE=3 SV=1 128 364 2.0E-13
sp|Q8FT42|CARB_COREF Carbamoyl-phosphate synthase large chain OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=carB PE=3 SV=1 129 362 3.0E-13
sp|B8D1H3|CARB_HALOH Carbamoyl-phosphate synthase large chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=carB PE=3 SV=1 38 362 5.0E-13
sp|A2BJL3|CARB_HYPBU Carbamoyl-phosphate synthase large chain OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=carB PE=3 SV=1 123 375 1.0E-12
sp|B2GI87|CARB_KOCRD Carbamoyl-phosphate synthase large chain OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=carB PE=3 SV=1 128 362 1.0E-12
sp|Q9PEC1|CARB_XYLFA Carbamoyl-phosphate synthase large chain OS=Xylella fastidiosa (strain 9a5c) GN=carB PE=3 SV=1 128 365 2.0E-12
sp|Q1D6Y8|CARB_MYXXD Carbamoyl-phosphate synthase large chain OS=Myxococcus xanthus (strain DK 1622) GN=carB PE=3 SV=1 133 367 3.0E-12
sp|Q9ZB63|CARY_GEOSE Carbamoyl-phosphate synthase arginine-specific large chain OS=Geobacillus stearothermophilus GN=carB PE=1 SV=1 133 362 3.0E-12
sp|Q67Q54|CARB_SYMTH Carbamoyl-phosphate synthase large chain OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=carB PE=3 SV=1 129 368 3.0E-12
sp|Q87EB8|CARB_XYLFT Carbamoyl-phosphate synthase large chain OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=carB PE=3 SV=1 128 365 4.0E-12
sp|P58943|CARB_XANCP Carbamoyl-phosphate synthase large chain OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=carB PE=3 SV=1 128 367 4.0E-12
sp|Q9CCR2|CARB_MYCLE Carbamoyl-phosphate synthase large chain OS=Mycobacterium leprae (strain TN) GN=carB PE=3 SV=2 129 362 8.0E-12
sp|A5D508|CARB_PELTS Carbamoyl-phosphate synthase large chain OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=carB PE=3 SV=1 137 363 1.0E-11
sp|P55641|Y4RH_RHISN Uncharacterized protein y4rH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01790 PE=3 SV=1 15 254 1.0E-11
sp|P9WPK3|CARB_MYCTU Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=carB PE=1 SV=1 129 362 1.0E-11
sp|P9WPK2|CARB_MYCTO Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=carB PE=3 SV=1 129 362 1.0E-11
sp|Q7U054|CARB_MYCBO Carbamoyl-phosphate synthase large chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=carB PE=3 SV=1 129 362 2.0E-11
sp|Q9KXR6|CARB_STRCO Carbamoyl-phosphate synthase large chain OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=carB PE=3 SV=1 129 362 2.0E-11
sp|B9KXM5|CARB_THERP Carbamoyl-phosphate synthase large chain OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=carB PE=3 SV=1 129 363 2.0E-11
sp|Q1IPK2|CARB_KORVE Carbamoyl-phosphate synthase large chain OS=Koribacter versatilis (strain Ellin345) GN=carB PE=3 SV=1 129 362 3.0E-11
sp|P58942|CARB_XANAC Carbamoyl-phosphate synthase large chain OS=Xanthomonas axonopodis pv. citri (strain 306) GN=carB PE=3 SV=1 128 367 3.0E-11
sp|A0JX72|CARB_ARTS2 Carbamoyl-phosphate synthase large chain OS=Arthrobacter sp. (strain FB24) GN=carB PE=3 SV=1 128 362 7.0E-11
sp|Q8K9Z7|CARB_BUCAP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=carB PE=3 SV=3 103 371 7.0E-11
sp|A9WSA8|CARB_RENSM Carbamoyl-phosphate synthase large chain OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=carB PE=3 SV=1 128 362 7.0E-11
sp|A1T8H1|CARB_MYCVP Carbamoyl-phosphate synthase large chain OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=carB PE=3 SV=1 129 362 8.0E-11
sp|O27077|CARB_METTH Carbamoyl-phosphate synthase large chain OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=carB PE=3 SV=2 135 368 1.0E-10
sp|C1CXR4|CARB_DEIDV Carbamoyl-phosphate synthase large chain OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=carB PE=3 SV=1 128 366 1.0E-10
sp|A6WCC6|CARB_KINRD Carbamoyl-phosphate synthase large chain OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=carB PE=3 SV=1 129 362 1.0E-10
sp|B0K4D7|CARB_THEPX Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter sp. (strain X514) GN=carB PE=3 SV=1 133 362 2.0E-10
sp|Q8XZ83|CARB_RALSO Carbamoyl-phosphate synthase large chain OS=Ralstonia solanacearum (strain GMI1000) GN=carB PE=3 SV=1 128 364 2.0E-10
sp|A7GE89|CARB_CLOBL Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=carB PE=3 SV=1 133 362 2.0E-10
sp|B8H8U5|CARB_ARTCA Carbamoyl-phosphate synthase large chain OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=carB PE=3 SV=1 128 362 2.0E-10
sp|B1W463|CARB_STRGG Carbamoyl-phosphate synthase large chain OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=carB PE=3 SV=1 129 362 2.0E-10
sp|C1FNY3|CARB_CLOBJ Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Kyoto / Type A2) GN=carB PE=3 SV=1 133 362 2.0E-10
sp|P57244|CARB_BUCAI Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=carB PE=3 SV=2 103 369 2.0E-10
sp|Q1IWM0|CARB_DEIGD Carbamoyl-phosphate synthase large chain OS=Deinococcus geothermalis (strain DSM 11300) GN=carB PE=3 SV=1 128 366 2.0E-10
sp|Q7UJ58|CARB_RHOBA Carbamoyl-phosphate synthase large chain OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=carB PE=3 SV=1 129 369 2.0E-10
sp|Q827Q7|CARB_STRAW Carbamoyl-phosphate synthase large chain OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=carB PE=3 SV=1 129 362 3.0E-10
sp|Q58776|CARB2_METJA Carbamoyl-phosphate synthase large chain, C-terminal section OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=carB2 PE=3 SV=1 129 362 3.0E-10
sp|Q6A914|CARB_PROAC Carbamoyl-phosphate synthase large chain OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=carB PE=3 SV=1 136 364 3.0E-10
sp|C1F1S6|CARB_ACIC5 Carbamoyl-phosphate synthase large chain OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=carB PE=3 SV=1 129 362 4.0E-10
sp|Q88DU6|CARB_PSEPK Carbamoyl-phosphate synthase large chain OS=Pseudomonas putida (strain KT2440) GN=carB PE=3 SV=2 128 369 4.0E-10
sp|Q970U7|CARB_SULTO Carbamoyl-phosphate synthase large chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=carB PE=3 SV=1 37 362 4.0E-10
sp|Q9RWK0|CARB_DEIRA Carbamoyl-phosphate synthase large chain OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=carB PE=3 SV=1 128 366 5.0E-10
sp|Q04H29|CARB_OENOB Carbamoyl-phosphate synthase large chain OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=carB PE=3 SV=1 133 362 6.0E-10
sp|C3NH23|CARB_SULIN Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=carB PE=3 SV=1 38 362 6.0E-10
sp|Q1B9F9|CARB_MYCSS Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain MCS) GN=carB PE=3 SV=1 129 362 6.0E-10
sp|A1UFK4|CARB_MYCSK Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain KMS) GN=carB PE=3 SV=1 129 362 6.0E-10
sp|A3PZ65|CARB_MYCSJ Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain JLS) GN=carB PE=3 SV=1 129 362 6.0E-10
sp|Q03HB0|CARB_PEDPA Carbamoyl-phosphate synthase large chain OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=carB PE=3 SV=1 133 362 6.0E-10
sp|A4TBY6|CARB_MYCGI Carbamoyl-phosphate synthase large chain OS=Mycobacterium gilvum (strain PYR-GCK) GN=carB PE=3 SV=1 129 362 6.0E-10
sp|C4KHM7|CARB_SULIK Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=carB PE=3 SV=1 38 362 7.0E-10
sp|C3MW21|CARB_SULIM Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=carB PE=3 SV=1 38 362 8.0E-10
sp|C3N664|CARB_SULIA Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.27) GN=carB PE=3 SV=1 38 362 8.0E-10
sp|O28994|CARB_ARCFU Carbamoyl-phosphate synthase large chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carB PE=3 SV=1 129 366 8.0E-10
sp|C3NEM0|CARB_SULIY Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=carB PE=3 SV=1 38 362 8.0E-10
sp|C3MQE3|CARB_SULIL Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=carB PE=3 SV=1 38 362 8.0E-10
sp|A1R6Z3|CARB_ARTAT Carbamoyl-phosphate synthase large chain OS=Arthrobacter aurescens (strain TC1) GN=carB PE=3 SV=1 128 362 9.0E-10
sp|P07259|PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA2 PE=1 SV=5 129 360 9.0E-10
sp|Q8RG86|CARB_FUSNN Carbamoyl-phosphate synthase large chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=carB PE=3 SV=2 129 393 1.0E-09
sp|B3WEF5|CARB_LACCB Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain BL23) GN=carB PE=3 SV=1 133 362 1.0E-09
sp|Q038Z2|CARB_LACC3 Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain ATCC 334) GN=carB PE=3 SV=1 133 362 1.0E-09
sp|Q8RBK0|CARB_CALS4 Carbamoyl-phosphate synthase large chain OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=carB PE=3 SV=1 133 343 1.0E-09
sp|Q8F832|CARB_LEPIN Carbamoyl-phosphate synthase large chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=carB PE=3 SV=1 128 367 1.0E-09
sp|Q72NF1|CARB_LEPIC Carbamoyl-phosphate synthase large chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=carB PE=3 SV=1 128 367 1.0E-09
sp|P96495|CARB_THET2 Carbamoyl-phosphate synthase large chain OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=carB PE=3 SV=2 128 364 1.0E-09
sp|B1I4M8|CARB_DESAP Carbamoyl-phosphate synthase large chain OS=Desulforudis audaxviator (strain MP104C) GN=carB PE=3 SV=1 129 362 2.0E-09
sp|B8D1H3|CARB_HALOH Carbamoyl-phosphate synthase large chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=carB PE=3 SV=1 133 362 2.0E-09
sp|Q67Q54|CARB_SYMTH Carbamoyl-phosphate synthase large chain OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=carB PE=3 SV=1 129 362 2.0E-09
sp|Q8TUT7|CARB2_METKA Carbamoyl-phosphate synthase large chain, C-terminal section OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=carB2 PE=3 SV=1 137 330 2.0E-09
sp|Q5SKN1|CARB_THET8 Carbamoyl-phosphate synthase large chain OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=carB PE=3 SV=1 128 364 2.0E-09
sp|B2A170|CARB_NATTJ Carbamoyl-phosphate synthase large chain OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=carB PE=3 SV=1 176 362 2.0E-09
sp|Q7M8I0|PURT_WOLSU Phosphoribosylglycinamide formyltransferase 2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=purT PE=3 SV=1 39 330 3.0E-09
sp|O67233|CARB2_AQUAE Carbamoyl-phosphate synthase large chain, C-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB2 PE=3 SV=1 128 362 3.0E-09
sp|P46537|CARB_BACCL Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus caldolyticus GN=pyrAB PE=3 SV=1 133 362 4.0E-09
sp|P38100|CARB_PSEAE Carbamoyl-phosphate synthase large chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=carB PE=3 SV=3 103 369 4.0E-09
sp|Q1AVY9|CARB_RUBXD Carbamoyl-phosphate synthase large chain OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=carB PE=3 SV=1 176 362 5.0E-09
sp|Q09794|PYR1_SCHPO Protein ura1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura1 PE=1 SV=1 50 356 5.0E-09
sp|P18185|CARY_BACSU Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus subtilis (strain 168) GN=carB PE=3 SV=4 55 362 5.0E-09
sp|Q9K8V7|CARY_BACHD Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=carB PE=3 SV=1 129 365 5.0E-09
sp|B0KBW4|CARB_THEP3 Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=carB PE=3 SV=1 133 343 6.0E-09
sp|Q8YQL2|CARB_NOSS1 Carbamoyl-phosphate synthase large chain OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=carB PE=3 SV=1 62 371 7.0E-09
sp|B9EXM2|CARB_ORYSJ Carbamoyl-phosphate synthase large chain, chloroplastic OS=Oryza sativa subsp. japonica GN=CARB PE=2 SV=1 137 369 8.0E-09
sp|Q9Z701|MUDD_CHLPN Bifunctional enzyme MurC/Ddl OS=Chlamydia pneumoniae GN=murC/ddl PE=3 SV=1 120 329 8.0E-09
sp|Q59969|CARB_SULSO Carbamoyl-phosphate synthase large chain OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=carB PE=3 SV=1 38 362 8.0E-09
sp|C4ZEK2|CARB_EUBR3 Carbamoyl-phosphate synthase large chain OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=carB PE=3 SV=1 135 365 8.0E-09
sp|C4ZEK2|CARB_EUBR3 Carbamoyl-phosphate synthase large chain OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=carB PE=3 SV=1 37 375 1.0E-08
sp|Q4L574|PURK_STAHJ N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purK PE=3 SV=2 146 330 1.0E-08
sp|Q98I87|CARB_RHILO Carbamoyl-phosphate synthase large chain OS=Rhizobium loti (strain MAFF303099) GN=carB PE=3 SV=1 128 359 1.0E-08
sp|P58944|CARB_METMA Carbamoyl-phosphate synthase large chain OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=carB PE=3 SV=1 119 362 1.0E-08
sp|B2THH3|CARB_CLOBB Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=carB PE=3 SV=1 133 362 1.0E-08
sp|C4L5W3|CARB_EXISA Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=carB PE=3 SV=1 129 364 1.0E-08
sp|O50302|CARB_GEOSE Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Geobacillus stearothermophilus GN=pyrAB PE=3 SV=1 133 362 1.0E-08
sp|A5D508|CARB_PELTS Carbamoyl-phosphate synthase large chain OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=carB PE=3 SV=1 137 362 2.0E-08
sp|P18185|CARY_BACSU Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus subtilis (strain 168) GN=carB PE=3 SV=4 133 362 2.0E-08
sp|B1KT07|CARB_CLOBM Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=carB PE=3 SV=1 133 362 2.0E-08
sp|Q87WP4|CARB_PSESM Carbamoyl-phosphate synthase large chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=carB PE=3 SV=1 103 369 2.0E-08
sp|Q7VP67|CARB_HAEDU Carbamoyl-phosphate synthase large chain OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=carB PE=3 SV=1 128 369 2.0E-08
sp|B1YIR9|CARB_EXIS2 Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=carB PE=3 SV=1 137 375 2.0E-08
sp|Q4J8E8|CARB_SULAC Carbamoyl-phosphate synthase large chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=carB PE=3 SV=1 36 362 2.0E-08
sp|P58941|CARB_STRP8 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=carB PE=3 SV=1 129 363 2.0E-08
sp|Q5XCR6|CARB_STRP6 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=carB PE=3 SV=2 129 363 2.0E-08
sp|B0REV9|CARB_CLAMS Carbamoyl-phosphate synthase large chain OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=carB PE=3 SV=1 129 368 2.0E-08
sp|A2RF60|CARB_STRPG Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=carB PE=3 SV=1 129 363 2.0E-08
sp|A5UKG5|CARB_METS3 Carbamoyl-phosphate synthase large chain OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=carB PE=3 SV=1 136 367 2.0E-08
sp|B2A170|CARB_NATTJ Carbamoyl-phosphate synthase large chain OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=carB PE=3 SV=1 180 361 3.0E-08
sp|C4L5W3|CARB_EXISA Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=carB PE=3 SV=1 169 362 3.0E-08
sp|Q9A0C6|CARB_STRP1 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M1 GN=carB PE=3 SV=1 129 363 3.0E-08
sp|Q4L5Q5|CARB_STAHJ Carbamoyl-phosphate synthase large chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=carB PE=3 SV=1 129 366 3.0E-08
sp|B8DTW3|CARB_BIFA0 Carbamoyl-phosphate synthase large chain OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=carB PE=3 SV=1 129 361 3.0E-08
sp|Q732I3|CARB_BACC1 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=carB PE=3 SV=1 129 363 3.0E-08
sp|Q9CKV0|CARB_PASMU Carbamoyl-phosphate synthase large chain OS=Pasteurella multocida (strain Pm70) GN=carB PE=3 SV=1 103 369 3.0E-08
sp|B2UX86|CARB_CLOBA Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=carB PE=3 SV=1 133 362 3.0E-08
sp|Q03HB0|CARB_PEDPA Carbamoyl-phosphate synthase large chain OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=carB PE=3 SV=1 129 364 4.0E-08
sp|Q9RLS9|CARY_LACPL Carbamoyl-phosphate synthase arginine-specific large chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=carB PE=2 SV=3 128 343 4.0E-08
sp|Q8EYF0|PURT_LEPIN Phosphoribosylglycinamide formyltransferase 2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=purT PE=3 SV=1 38 330 4.0E-08
sp|Q72LY0|PURT_LEPIC Phosphoribosylglycinamide formyltransferase 2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=purT PE=3 SV=1 38 330 4.0E-08
sp|A9VTC6|CARB_BACWK Carbamoyl-phosphate synthase large chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=carB PE=3 SV=1 129 363 4.0E-08
sp|O50236|CARB_ZYMMO Carbamoyl-phosphate synthase large chain OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=carB PE=3 SV=2 128 362 5.0E-08
sp|Q55756|CARB_SYNY3 Carbamoyl-phosphate synthase large chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=carB PE=3 SV=2 142 369 5.0E-08
sp|Q8CPJ4|CARB_STAES Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=carB PE=3 SV=1 129 366 5.0E-08
sp|C5CCF1|CARB_MICLC Carbamoyl-phosphate synthase large chain OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=carB PE=3 SV=1 128 362 5.0E-08
sp|Q1WVA9|CARB_LACS1 Carbamoyl-phosphate synthase large chain OS=Lactobacillus salivarius (strain UCC118) GN=carB PE=3 SV=1 133 362 5.0E-08
sp|Q03WW7|CARB_LEUMM Carbamoyl-phosphate synthase large chain OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=carB PE=3 SV=1 170 362 5.0E-08
sp|P25994|CARB_BACSU Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus subtilis (strain 168) GN=pyrAB PE=3 SV=1 169 362 7.0E-08
sp|Q8RBK0|CARB_CALS4 Carbamoyl-phosphate synthase large chain OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=carB PE=3 SV=1 112 363 8.0E-08
sp|P0DA14|CARB_STRP3 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=carB PE=3 SV=1 129 363 8.0E-08
sp|B3WEF5|CARB_LACCB Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain BL23) GN=carB PE=3 SV=1 184 374 1.0E-07
sp|Q54975|PURK_SYNE7 N5-carboxyaminoimidazole ribonucleotide synthase OS=Synechococcus elongatus (strain PCC 7942) GN=purK PE=3 SV=2 132 330 1.0E-07
sp|C1KWD4|CARB_LISMC Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=carB PE=3 SV=1 129 365 1.0E-07
sp|B9IVW3|CARB_BACCQ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain Q1) GN=carB PE=3 SV=1 129 363 1.0E-07
sp|B7HLM0|CARB_BACC7 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH187) GN=carB PE=3 SV=1 129 363 1.0E-07
sp|P59448|CARB_BUCBP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=carB PE=3 SV=1 103 369 1.0E-07
sp|O93937|PYR1_EMENI Protein pyrABCN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrABCN PE=3 SV=2 140 361 1.0E-07
sp|Q38X24|CARB_LACSS Carbamoyl-phosphate synthase large chain OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=carB PE=3 SV=1 170 362 1.0E-07
sp|A5CRX5|CARB_CLAM3 Carbamoyl-phosphate synthase large chain OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=carB PE=3 SV=1 129 368 1.0E-07
sp|Q6HES8|CARB_BACHK Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=carB PE=3 SV=1 129 363 1.0E-07
sp|Q5LD90|PURT_BACFN Phosphoribosylglycinamide formyltransferase 2 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=purT PE=3 SV=1 37 385 1.0E-07
sp|Q5HPY8|CARB_STAEQ Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=carB PE=3 SV=1 129 366 1.0E-07
sp|Q038Z2|CARB_LACC3 Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain ATCC 334) GN=carB PE=3 SV=1 184 374 2.0E-07
sp|P46537|CARB_BACCL Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus caldolyticus GN=pyrAB PE=3 SV=1 129 363 2.0E-07
sp|Q732I3|CARB_BACC1 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=carB PE=3 SV=1 123 362 2.0E-07
sp|B2UX86|CARB_CLOBA Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=carB PE=3 SV=1 187 367 2.0E-07
sp|A9VTC6|CARB_BACWK Carbamoyl-phosphate synthase large chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=carB PE=3 SV=1 123 362 2.0E-07
sp|Q03WW7|CARB_LEUMM Carbamoyl-phosphate synthase large chain OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=carB PE=3 SV=1 190 364 2.0E-07
sp|B7H6M2|CARB_BACC4 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain B4264) GN=carB PE=3 SV=1 129 363 2.0E-07
sp|Q49WI9|PURK_STAS1 N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purK PE=3 SV=1 146 330 2.0E-07
sp|A6LPD9|CARB_CLOB8 Carbamoyl-phosphate synthase large chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=carB PE=3 SV=1 128 367 2.0E-07
sp|A6LPD9|CARB_CLOB8 Carbamoyl-phosphate synthase large chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=carB PE=3 SV=1 133 362 2.0E-07
sp|Q819S3|CARB_BACCR Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=carB PE=3 SV=1 129 363 2.0E-07
sp|C1EPQ0|CARB_BACC3 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain 03BB102) GN=carB PE=3 SV=1 129 363 2.0E-07
sp|Q81WF2|CARB_BACAN Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis GN=carB PE=3 SV=1 129 363 2.0E-07
sp|A0RHQ8|CARB_BACAH Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis (strain Al Hakam) GN=carB PE=3 SV=1 129 363 2.0E-07
sp|C3L740|CARB_BACAC Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=carB PE=3 SV=1 129 363 2.0E-07
sp|C3P656|CARB_BACAA Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain A0248) GN=carB PE=3 SV=1 129 363 2.0E-07
sp|Q8NX94|PURK_STAAW N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain MW2) GN=purK PE=3 SV=1 146 330 2.0E-07
sp|Q6GAE8|PURK_STAAS N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain MSSA476) GN=purK PE=3 SV=1 146 330 2.0E-07
sp|Q5HH19|PURK_STAAC N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain COL) GN=purK PE=3 SV=1 146 330 2.0E-07
sp|B7JJX3|CARB_BACC0 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH820) GN=carB PE=3 SV=1 129 363 2.0E-07
sp|Q7A695|PURK_STAAN N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain N315) GN=purK PE=1 SV=1 146 330 2.0E-07
sp|Q99V32|PURK_STAAM N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purK PE=3 SV=1 146 330 2.0E-07
sp|Q636E0|CARB_BACCZ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ZK / E33L) GN=carB PE=3 SV=1 129 363 2.0E-07
sp|Q03LT8|CARB_STRTD Carbamoyl-phosphate synthase large chain OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=carB PE=3 SV=1 129 362 2.0E-07
sp|Q5M5F6|CARB_STRT2 Carbamoyl-phosphate synthase large chain OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=carB PE=3 SV=1 129 362 2.0E-07
sp|Q5M0W9|CARB_STRT1 Carbamoyl-phosphate synthase large chain OS=Streptococcus thermophilus (strain CNRZ 1066) GN=carB PE=3 SV=1 129 362 2.0E-07
sp|C0M756|CARB_STRE4 Carbamoyl-phosphate synthase large chain OS=Streptococcus equi subsp. equi (strain 4047) GN=carB PE=3 SV=1 129 393 2.0E-07
sp|P05115|BCCP_SOLLC Biotin carboxyl carrier protein of acetyl-CoA carboxylase (Fragment) OS=Solanum lycopersicum PE=2 SV=1 1123 1182 2.0E-07
sp|O94313|CARB_SCHPO Carbamoyl-phosphate synthase arginine-specific large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg4 PE=3 SV=1 53 374 2.0E-07
sp|Q97FT3|CARB_CLOAB Carbamoyl-phosphate synthase large chain OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=carB PE=3 SV=1 121 362 3.0E-07
sp|B9KXM5|CARB_THERP Carbamoyl-phosphate synthase large chain OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=carB PE=3 SV=1 133 362 3.0E-07
sp|Q04H29|CARB_OENOB Carbamoyl-phosphate synthase large chain OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=carB PE=3 SV=1 184 364 3.0E-07
sp|O50302|CARB_GEOSE Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Geobacillus stearothermophilus GN=pyrAB PE=3 SV=1 129 363 3.0E-07
sp|Q5HQA5|PURK_STAEQ N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purK PE=3 SV=1 146 330 3.0E-07
sp|Q834E2|CARB_ENTFA Carbamoyl-phosphate synthase large chain OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=carB PE=3 SV=1 129 363 3.0E-07
sp|Q8CPP2|PURK_STAES N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purK PE=3 SV=1 146 330 3.0E-07
sp|P0DA15|CARB_STRPQ Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=carB PE=3 SV=1 129 363 3.0E-07
sp|B7IUP6|CARB_BACC2 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain G9842) GN=carB PE=3 SV=1 129 363 3.0E-07
sp|B7IUP6|CARB_BACC2 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain G9842) GN=carB PE=3 SV=1 123 362 3.0E-07
sp|B9DPN2|CARB_STACT Carbamoyl-phosphate synthase large chain OS=Staphylococcus carnosus (strain TM300) GN=carB PE=3 SV=1 133 362 3.0E-07
sp|O67869|CARB1_AQUAE Carbamoyl-phosphate synthase large chain, N-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB1 PE=3 SV=1 133 362 3.0E-07
sp|B1MZ74|CARB_LEUCK Carbamoyl-phosphate synthase large chain OS=Leuconostoc citreum (strain KM20) GN=carB PE=3 SV=1 190 364 3.0E-07
sp|Q9K9V9|CARB_BACHD Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrAB PE=3 SV=1 129 363 3.0E-07
sp|Q74J34|CARB_LACJO Carbamoyl-phosphate synthase large chain OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=carB PE=3 SV=1 140 362 3.0E-07
sp|P14846|CARB_SALTY Carbamoyl-phosphate synthase large chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=carB PE=3 SV=4 133 362 4.0E-07
sp|Q8Z9L7|CARB_SALTI Carbamoyl-phosphate synthase large chain OS=Salmonella typhi GN=carB PE=3 SV=3 133 362 4.0E-07
sp|O28994|CARB_ARCFU Carbamoyl-phosphate synthase large chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carB PE=3 SV=1 133 449 4.0E-07
sp|B0KBW4|CARB_THEP3 Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=carB PE=3 SV=1 180 363 4.0E-07
sp|Q4L5Q5|CARB_STAHJ Carbamoyl-phosphate synthase large chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=carB PE=3 SV=1 133 362 4.0E-07
sp|B8DTW3|CARB_BIFA0 Carbamoyl-phosphate synthase large chain OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=carB PE=3 SV=1 133 391 4.0E-07
sp|Q74J34|CARB_LACJO Carbamoyl-phosphate synthase large chain OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=carB PE=3 SV=1 173 365 4.0E-07
sp|Q8G815|CARB_BIFLO Carbamoyl-phosphate synthase large chain OS=Bifidobacterium longum (strain NCC 2705) GN=carB PE=3 SV=1 129 360 4.0E-07
sp|B3DQ32|CARB_BIFLD Carbamoyl-phosphate synthase large chain OS=Bifidobacterium longum (strain DJO10A) GN=carB PE=3 SV=1 129 360 4.0E-07
sp|Q0SPY4|CARB_CLOPS Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain SM101 / Type A) GN=carB PE=3 SV=1 133 378 4.0E-07
sp|Q9JXW8|CARB_NEIMB Carbamoyl-phosphate synthase large chain OS=Neisseria meningitidis serogroup B (strain MC58) GN=carB PE=3 SV=1 128 369 4.0E-07
sp|Q9CFV2|CARB_LACLA Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=carB PE=3 SV=1 129 366 5.0E-07
sp|A9KI94|CARB_CLOPH Carbamoyl-phosphate synthase large chain OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=carB PE=3 SV=1 135 363 5.0E-07
sp|A9KI94|CARB_CLOPH Carbamoyl-phosphate synthase large chain OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=carB PE=3 SV=1 185 362 5.0E-07
sp|B1HQC1|CARB_LYSSC Carbamoyl-phosphate synthase large chain OS=Lysinibacillus sphaericus (strain C3-41) GN=carB PE=3 SV=1 137 363 5.0E-07
sp|B5XKW2|CARB_STRPZ Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=carB PE=3 SV=1 129 363 5.0E-07
sp|C1EPQ0|CARB_BACC3 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain 03BB102) GN=carB PE=3 SV=1 123 362 6.0E-07
sp|Q81WF2|CARB_BACAN Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis GN=carB PE=3 SV=1 123 362 6.0E-07
sp|A0RHQ8|CARB_BACAH Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis (strain Al Hakam) GN=carB PE=3 SV=1 123 362 6.0E-07
sp|C3L740|CARB_BACAC Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=carB PE=3 SV=1 123 362 6.0E-07
sp|C3P656|CARB_BACAA Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain A0248) GN=carB PE=3 SV=1 123 362 6.0E-07
sp|B7JJX3|CARB_BACC0 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH820) GN=carB PE=3 SV=1 123 362 6.0E-07
sp|Q6GI19|PURK_STAAR N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain MRSA252) GN=purK PE=3 SV=1 146 330 6.0E-07
sp|Q9JW02|CARB_NEIMA Carbamoyl-phosphate synthase large chain OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=carB PE=3 SV=1 128 369 6.0E-07
sp|Q469Z7|CARB_METBF Carbamoyl-phosphate synthase large chain OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=carB PE=3 SV=1 119 362 6.0E-07
sp|Q8DUP3|CARB_STRMU Carbamoyl-phosphate synthase large chain OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=carB PE=3 SV=1 176 362 6.0E-07
sp|Q8ZW35|LEU1_PYRAE Probable 2-isopropylmalate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuA PE=3 SV=1 674 827 6.0E-07
sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 1106 1182 7.0E-07
sp|B1YIR9|CARB_EXIS2 Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=carB PE=3 SV=1 129 365 7.0E-07
sp|Q9PLG1|MUDD_CHLMU Bifunctional enzyme MurC/Ddl OS=Chlamydia muridarum (strain MoPn / Nigg) GN=murC/ddl PE=3 SV=2 115 329 7.0E-07
sp|Q8XZ83|CARB_RALSO Carbamoyl-phosphate synthase large chain OS=Ralstonia solanacearum (strain GMI1000) GN=carB PE=3 SV=1 133 362 8.0E-07
sp|Q87WP4|CARB_PSESM Carbamoyl-phosphate synthase large chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=carB PE=3 SV=1 133 362 8.0E-07
sp|P25994|CARB_BACSU Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus subtilis (strain 168) GN=pyrAB PE=3 SV=1 129 366 8.0E-07
sp|Q38X24|CARB_LACSS Carbamoyl-phosphate synthase large chain OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=carB PE=3 SV=1 129 362 8.0E-07
sp|B1IC65|CARB_STRPI Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=carB PE=3 SV=1 128 362 8.0E-07
sp|C0MEH1|CARB_STRS7 Carbamoyl-phosphate synthase large chain OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=carB PE=3 SV=1 129 359 8.0E-07
sp|B0K4D7|CARB_THEPX Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter sp. (strain X514) GN=carB PE=3 SV=1 135 363 9.0E-07
sp|B9IVW3|CARB_BACCQ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain Q1) GN=carB PE=3 SV=1 123 362 9.0E-07
sp|B7HLM0|CARB_BACC7 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH187) GN=carB PE=3 SV=1 123 362 9.0E-07
sp|Q636E0|CARB_BACCZ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ZK / E33L) GN=carB PE=3 SV=1 123 362 9.0E-07
sp|Q0SPY4|CARB_CLOPS Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain SM101 / Type A) GN=carB PE=3 SV=1 188 363 9.0E-07
sp|P02904|BCCP_PROFR Methylmalonyl-CoA carboxyltransferase 1.3S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=1 1123 1186 9.0E-07
sp|Q8TNY4|CARB_METAC Carbamoyl-phosphate synthase large chain OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=carB PE=3 SV=1 119 362 9.0E-07
sp|Q91293|CPSM_LITCT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Lithobates catesbeiana PE=2 SV=1 167 463 9.0E-07
sp|Q42601|CARB_ARATH Carbamoyl-phosphate synthase large chain, chloroplastic OS=Arabidopsis thaliana GN=CARB PE=1 SV=1 142 369 9.0E-07
sp|Q8DZQ7|CARB_STRA5 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=carB PE=3 SV=1 129 362 9.0E-07
sp|P39771|PURT_BACSU Phosphoribosylglycinamide formyltransferase 2 OS=Bacillus subtilis (strain 168) GN=purT PE=3 SV=2 34 330 9.0E-07
sp|Q8XHB3|CARB_CLOPE Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain 13 / Type A) GN=carB PE=3 SV=1 188 363 9.0E-07
sp|B7GPW2|CARB_BIFLS Carbamoyl-phosphate synthase large chain OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=carB PE=3 SV=1 129 360 9.0E-07
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 1123 1182 1.0E-06
sp|B2THH3|CARB_CLOBB Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=carB PE=3 SV=1 187 367 1.0E-06
sp|Q8CPJ4|CARB_STAES Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=carB PE=3 SV=1 133 362 1.0E-06
sp|Q6HES8|CARB_BACHK Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=carB PE=3 SV=1 123 362 1.0E-06
sp|Q5HPY8|CARB_STAEQ Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=carB PE=3 SV=1 133 362 1.0E-06
sp|Q9K9V9|CARB_BACHD Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrAB PE=3 SV=1 169 362 1.0E-06
sp|Q8XHB3|CARB_CLOPE Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain 13 / Type A) GN=carB PE=3 SV=1 133 378 1.0E-06
sp|Q8E5F5|CARB_STRA3 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype III (strain NEM316) GN=carB PE=3 SV=1 129 362 1.0E-06
sp|B8DDR7|CARB_LISMH Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=carB PE=3 SV=1 129 365 1.0E-06
sp|Q3K150|CARB_STRA1 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=carB PE=3 SV=1 129 362 1.0E-06
sp|Q71YI1|CARB_LISMF Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=carB PE=3 SV=1 129 365 1.0E-06
sp|Q64UB2|PURT_BACFR Phosphoribosylglycinamide formyltransferase 2 OS=Bacteroides fragilis (strain YCH46) GN=purT PE=3 SV=1 37 385 1.0E-06
sp|Q0TM79|CARB_CLOP1 Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=carB PE=3 SV=1 133 378 1.0E-06
sp|Q0TM79|CARB_CLOP1 Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=carB PE=3 SV=1 188 363 1.0E-06
sp|Q8ZY48|CARB_PYRAE Carbamoyl-phosphate synthase large chain OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=carB PE=3 SV=1 35 362 1.0E-06
sp|A7Z0Z2|PURT_BACMF Phosphoribosylglycinamide formyltransferase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=purT PE=3 SV=1 34 330 1.0E-06
sp|Q02YG5|CARB_LACLS Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=carB PE=3 SV=1 129 363 1.0E-06
sp|A2SQ53|CARB_METLZ Carbamoyl-phosphate synthase large chain OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=carB PE=3 SV=1 141 370 1.0E-06
sp|Q8FLB0|CARB_ECOL6 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=carB PE=3 SV=3 133 362 2.0E-06
sp|Q8ZIL4|CARB_YERPE Carbamoyl-phosphate synthase large chain OS=Yersinia pestis GN=carB PE=3 SV=3 137 362 2.0E-06
sp|Q1D6Y8|CARB_MYXXD Carbamoyl-phosphate synthase large chain OS=Myxococcus xanthus (strain DK 1622) GN=carB PE=3 SV=1 133 362 2.0E-06
sp|P58941|CARB_STRP8 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=carB PE=3 SV=1 129 362 2.0E-06
sp|Q5XCR6|CARB_STRP6 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=carB PE=3 SV=2 129 362 2.0E-06
sp|A2RF60|CARB_STRPG Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=carB PE=3 SV=1 129 362 2.0E-06
sp|A5UKG5|CARB_METS3 Carbamoyl-phosphate synthase large chain OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=carB PE=3 SV=1 175 391 2.0E-06
sp|Q9A0C6|CARB_STRP1 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M1 GN=carB PE=3 SV=1 129 362 2.0E-06
sp|B7H6M2|CARB_BACC4 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain B4264) GN=carB PE=3 SV=1 123 362 2.0E-06
sp|Q819S3|CARB_BACCR Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=carB PE=3 SV=1 123 362 2.0E-06
sp|C0M756|CARB_STRE4 Carbamoyl-phosphate synthase large chain OS=Streptococcus equi subsp. equi (strain 4047) GN=carB PE=3 SV=1 133 359 2.0E-06
sp|B5XKW2|CARB_STRPZ Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=carB PE=3 SV=1 129 362 2.0E-06
sp|C0MEH1|CARB_STRS7 Carbamoyl-phosphate synthase large chain OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=carB PE=3 SV=1 129 393 2.0E-06
sp|Q8DZQ7|CARB_STRA5 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=carB PE=3 SV=1 133 362 2.0E-06
sp|Q8E5F5|CARB_STRA3 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype III (strain NEM316) GN=carB PE=3 SV=1 133 362 2.0E-06
sp|Q3K150|CARB_STRA1 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=carB PE=3 SV=1 133 362 2.0E-06
sp|Q8RSS3|CARB_HALER Carbamoyl-phosphate synthase large chain OS=Halomonas eurihalina GN=carB PE=3 SV=1 128 367 2.0E-06
sp|O32771|CARB_LACLM Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=carB PE=2 SV=2 129 363 2.0E-06
sp|A0AJU0|CARB_LISW6 Carbamoyl-phosphate synthase large chain OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=carB PE=3 SV=1 129 365 2.0E-06
sp|A0AJU0|CARB_LISW6 Carbamoyl-phosphate synthase large chain OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=carB PE=3 SV=1 153 362 2.0E-06
sp|Q8TWX0|CARB1_METKA Carbamoyl-phosphate synthase large chain, N-terminal section OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=carB1 PE=3 SV=1 141 343 2.0E-06
sp|A3CNI5|CARB_STRSV Carbamoyl-phosphate synthase large chain OS=Streptococcus sanguinis (strain SK36) GN=carB PE=3 SV=1 148 362 2.0E-06
sp|A8YVZ3|CARB_LACH4 Carbamoyl-phosphate synthase large chain OS=Lactobacillus helveticus (strain DPC 4571) GN=carB PE=3 SV=1 148 362 2.0E-06
sp|C1CR31|CARB_STRZT Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=carB PE=3 SV=1 104 362 2.0E-06
sp|Q97QE4|CARB_STRPN Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=carB PE=3 SV=1 104 362 2.0E-06
sp|Q04K48|CARB_STRP2 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=carB PE=3 SV=1 104 362 2.0E-06
sp|B2G564|CARB_LACRJ Carbamoyl-phosphate synthase large chain OS=Lactobacillus reuteri (strain JCM 1112) GN=carB PE=3 SV=1 133 362 2.0E-06
sp|A5VHN6|CARB_LACRD Carbamoyl-phosphate synthase large chain OS=Lactobacillus reuteri (strain DSM 20016) GN=carB PE=3 SV=1 133 362 2.0E-06
sp|B2IQ67|CARB_STRPS Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain CGSP14) GN=carB PE=3 SV=1 104 362 2.0E-06
sp|B8ZJT9|CARB_STRPJ Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=carB PE=3 SV=1 104 362 2.0E-06
sp|Q8CWR0|CARB_STRR6 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=carB PE=3 SV=1 104 362 2.0E-06
sp|C1C7Q3|CARB_STRP7 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain 70585) GN=carB PE=3 SV=1 104 362 2.0E-06
sp|A0B8K9|CARB_METTP Carbamoyl-phosphate synthase large chain OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=carB PE=3 SV=1 119 391 2.0E-06
sp|P00968|CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) GN=carB PE=1 SV=2 133 362 3.0E-06
sp|P63738|CARB_SHIFL Carbamoyl-phosphate synthase large chain OS=Shigella flexneri GN=carB PE=3 SV=2 133 362 3.0E-06
sp|P63737|CARB_ECO57 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O157:H7 GN=carB PE=3 SV=2 133 362 3.0E-06
sp|O27077|CARB_METTH Carbamoyl-phosphate synthase large chain OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=carB PE=3 SV=2 190 391 3.0E-06
sp|Q88DU6|CARB_PSEPK Carbamoyl-phosphate synthase large chain OS=Pseudomonas putida (strain KT2440) GN=carB PE=3 SV=2 133 362 3.0E-06
sp|P0DA14|CARB_STRP3 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=carB PE=3 SV=1 129 362 3.0E-06
sp|P0DA15|CARB_STRPQ Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=carB PE=3 SV=1 129 362 3.0E-06
sp|A7GRL1|CARB_BACCN Carbamoyl-phosphate synthase large chain OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=carB PE=3 SV=1 123 362 3.0E-06
sp|Q49WY4|CARB_STAS1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=carB PE=3 SV=1 133 362 3.0E-06
sp|C1CEM9|CARB_STRZJ Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain JJA) GN=carB PE=3 SV=1 128 362 3.0E-06
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 135 362 3.0E-06
sp|Q047M8|CARB_LACDB Carbamoyl-phosphate synthase large chain OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=carB PE=3 SV=1 148 362 3.0E-06
sp|Q8A9W1|PURT_BACTN Phosphoribosylglycinamide formyltransferase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=purT PE=3 SV=1 37 385 3.0E-06
sp|Q55756|CARB_SYNY3 Carbamoyl-phosphate synthase large chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=carB PE=3 SV=2 133 362 4.0E-06
sp|C1KWD4|CARB_LISMC Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=carB PE=3 SV=1 153 362 4.0E-06
sp|B8DDR7|CARB_LISMH Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=carB PE=3 SV=1 153 362 4.0E-06
sp|Q71YI1|CARB_LISMF Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=carB PE=3 SV=1 153 362 4.0E-06
sp|A7GRL1|CARB_BACCN Carbamoyl-phosphate synthase large chain OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=carB PE=3 SV=1 129 363 4.0E-06
sp|B5E512|CARB_STRP4 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=carB PE=3 SV=1 128 362 4.0E-06
sp|Q8FZJ3|CARB_BRUSU Carbamoyl-phosphate synthase large chain OS=Brucella suis biovar 1 (strain 1330) GN=carB PE=3 SV=1 128 359 4.0E-06
sp|Q92AH3|CARB_LISIN Carbamoyl-phosphate synthase large chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=carB PE=3 SV=1 153 362 4.0E-06
sp|Q9PIL7|CARB_CAMJE Carbamoyl-phosphate synthase large chain OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=carB PE=3 SV=1 128 361 4.0E-06
sp|Q8Y665|CARB_LISMO Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=carB PE=3 SV=1 153 362 4.0E-06
sp|Q5FJC0|CARB_LACAC Carbamoyl-phosphate synthase large chain OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=carB PE=3 SV=1 140 362 4.0E-06
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 1115 1186 5.0E-06
sp|Q469Z7|CARB_METBF Carbamoyl-phosphate synthase large chain OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=carB PE=3 SV=1 139 367 5.0E-06
sp|Q8Y665|CARB_LISMO Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=carB PE=3 SV=1 129 365 5.0E-06
sp|Q1AVY9|CARB_RUBXD Carbamoyl-phosphate synthase large chain OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=carB PE=3 SV=1 128 363 6.0E-06
sp|Q8YQL2|CARB_NOSS1 Carbamoyl-phosphate synthase large chain OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=carB PE=3 SV=1 153 362 6.0E-06
sp|Q6GHN2|CARB_STAAR Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MRSA252) GN=carB PE=3 SV=1 153 362 6.0E-06
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 135 362 6.0E-06
sp|Q8RG86|CARB_FUSNN Carbamoyl-phosphate synthase large chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=carB PE=3 SV=2 176 362 7.0E-06
sp|A8Z3P0|CARB_STAAT Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|Q6GA10|CARB_STAAS Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MSSA476) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|A6QGA4|CARB_STAAE Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Newman) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|Q5HGM9|CARB_STAAC Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain COL) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|Q2FZ72|CARB_STAA8 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain NCTC 8325) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|Q2FHN5|CARB_STAA3 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain USA300) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|A1A0T4|CARB_BIFAA Carbamoyl-phosphate synthase large chain OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=carB PE=3 SV=1 133 391 7.0E-06
sp|P63740|CARB_STAAN Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain N315) GN=carB PE=1 SV=1 153 362 7.0E-06
sp|P63739|CARB_STAAM Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|A5IS88|CARB_STAA9 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH9) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|A6U122|CARB_STAA2 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH1) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|A7X1F4|CARB_STAA1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|Q9CIL5|DDL_LACLA D-alanine--D-alanine ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ddl PE=3 SV=1 108 328 7.0E-06
sp|Q2YXG5|CARB_STAAB Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=carB PE=3 SV=1 153 362 7.0E-06
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 135 362 7.0E-06
sp|P58940|CARB_STAAW Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MW2) GN=carB PE=3 SV=1 153 362 8.0E-06
sp|Q970U7|CARB_SULTO Carbamoyl-phosphate synthase large chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=carB PE=3 SV=1 129 348 9.0E-06
sp|A4TBY6|CARB_MYCGI Carbamoyl-phosphate synthase large chain OS=Mycobacterium gilvum (strain PYR-GCK) GN=carB PE=3 SV=1 179 362 9.0E-06
sp|B7GPW2|CARB_BIFLS Carbamoyl-phosphate synthase large chain OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=carB PE=3 SV=1 133 362 9.0E-06
sp|Q92AH3|CARB_LISIN Carbamoyl-phosphate synthase large chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=carB PE=3 SV=1 129 365 9.0E-06
sp|P63740|CARB_STAAN Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain N315) GN=carB PE=1 SV=1 129 363 9.0E-06
sp|P63739|CARB_STAAM Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=carB PE=3 SV=1 129 363 9.0E-06
sp|A5IS88|CARB_STAA9 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH9) GN=carB PE=3 SV=1 129 363 9.0E-06
sp|A6U122|CARB_STAA2 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH1) GN=carB PE=3 SV=1 129 363 9.0E-06
sp|A7X1F4|CARB_STAA1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=carB PE=3 SV=1 129 363 9.0E-06
sp|Q9ZAA7|GCDC_ACIFV Glutaconyl-CoA decarboxylase subunit gamma OS=Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4) GN=gcdC PE=1 SV=1 1118 1184 9.0E-06
sp|B9DRV7|CARB_STRU0 Carbamoyl-phosphate synthase large chain OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=carB PE=3 SV=1 175 363 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003824 catalytic activity Yes
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0046872 metal ion binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0016881 acid-amino acid ligase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0016874 ligase activity No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup275
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|605
Ophiocordyceps australis map64 (Brazil) OphauB2|278
Ophiocordyceps camponoti-floridani Ophcf2|00178
Ophiocordyceps camponoti-floridani Ophcf2|06907
Ophiocordyceps camponoti-rufipedis Ophun1|109 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1375
Ophiocordyceps kimflemingae Ophio5|2035
Ophiocordyceps kimflemingae Ophio5|5075
Ophiocordyceps subramaniannii Hirsu2|364
Ophiocordyceps subramaniannii Hirsu2|9807

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|109
MSVPQQALTFNDVFDDDDIDEPKSVHHIRANSSIMQLKKILVANRGEIPIRIFRTAHELSLHTIAVYSYEDRLSM
HRQKADEAYVIGHRGQYTPVGAYLAGDEIIKIALEHGAQLIHPGYGFLSENAEFARNVEKAGLIFVGPSPEVIDS
LGDKVSARKLAIAAGVPVVPGTEGAVAKFEEVESFTDKYGFPIIIKAAYGGGGRGMRVVRDAESLQEHFERATSE
AKSAFGNGTVFVERFLDKPKHIEVQLLGDNQGNIVHLYERDCSVQRRHQKVVEIAPAKDLPTETRDAILADAVKL
AKSVNYRNAGTAEFLVDQQNRYYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLAQLGLTQDRISTRGFA
IQCRITTEDPAKLFQPDTGKIEVYRSAGGNGVRLDGGNGFAGAVITPFYDSMLVKCTCQGSTYEIARRKVLRALI
EFRVRGVKTNIPFLASLLTHPTFIDGNCWTTFIDDTPQLFDLIGGQNRAQKLLAYLGDVAVNGSAIKGQIGDPKF
RGDIILPIIYAPDGSKIDVSQPCQKGWRNILVEKGPKAFAKAVRQYKGCLLMDTTWRDAHQSLLATRVRTVDLLN
IAKETSHALSNLYSLECWGGATFDVAMRFLYEDPWDRLRQMRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVD
QAKKNGVDIFRVFDALNDIDQLEVGIKAVHKAGGVAEGTVCYSGDMLNPGKKYNLEYYMALVDKLVKLDIHVLGI
KDMAGVLKPHAATLLIGSIRKKYPDLPIHVHTHDSAGTGVASMVACAKAGADAVDAATDSLSGMTSQPSINAILA
SLEGSDLDPGLDPKQVRALDTYWSQLRLLYSPFEAHLAGPDPEVYEHEIPGGQLTNMMFQASQLGLGSQWLETKK
AYEHANDLLGDIVKVTPTSKVVGDLAQFMVSNKLSAEDVKARASELDFPGSVLEFLEGLMGQPYGGFPEPLRSDA
LRGRRKLDKRPGLFLEPVDLVKAKKELLKKFGGPVTECDVASYVMYPKVFEDYKKFMQQYGDLSVLPTKYFLSRP
EIGEEFNVQLEKGKVLILKLLAVGPLSENTGQREVFFEMNGEVRQVTVVDKKAAVENVCRPKADPGDSSQVGAPM
SGVLVEMRVHEGSEVKKGDPLAVLSAMKMEMVISAPHSGKVASLQVKEGDSVDGSDLVCRITKA*
Coding >Ophun1|109
ATGTCGGTCCCTCAGCAGGCCCTCACCTTTAACGATGTCTTCGACGACGACGATATCGATGAGCCCAAGTCGGTG
CATCATATTCGCGCCAACTCGAGCATCATGCAACTCAAGAAGATCCTTGTTGCCAACCGTGGCGAAATTCCTATT
CGGATCTTCAGGACGGCCCATGAGCTATCGCTGCACACCATCGCCGTCTACAGTTACGAGGACCGTCTAAGCATG
CACCGCCAGAAGGCTGACGAGGCCTACGTCATCGGTCACCGCGGCCAGTATACCCCTGTCGGAGCCTATCTCGCC
GGCGATGAGATTATCAAGATCGCCCTCGAGCATGGCGCTCAACTAATCCACCCTGGCTACGGTTTCTTATCCGAG
AACGCCGAGTTCGCTCGCAATGTCGAAAAGGCCGGTCTTATTTTTGTTGGTCCGTCTCCTGAAGTCATCGACTCC
CTCGGCGACAAGGTATCGGCCCGCAAGCTGGCCATCGCCGCCGGCGTCCCCGTCGTGCCCGGAACCGAAGGCGCC
GTAGCCAAGTTCGAGGAAGTCGAGTCCTTTACCGACAAGTATGGCTTCCCCATCATCATCAAGGCAGCCTACGGT
GGCGGTGGTCGGGGCATGCGCGTCGTTCGTGATGCCGAAAGCCTGCAGGAGCATTTTGAGAGGGCCACGTCCGAG
GCCAAGTCGGCCTTTGGCAACGGCACCGTCTTCGTCGAGCGTTTCCTCGACAAGCCCAAGCACATCGAGGTTCAG
CTTCTGGGCGATAACCAGGGCAACATTGTTCATCTGTACGAGCGTGACTGCTCCGTTCAGCGCCGTCATCAAAAG
GTGGTCGAGATCGCCCCGGCCAAGGACCTCCCCACCGAGACGAGAGACGCCATCCTGGCCGACGCCGTCAAGCTG
GCCAAGTCGGTCAACTATCGCAACGCGGGCACGGCCGAGTTCCTGGTCGACCAGCAGAATCGATACTACTTCATC
GAGATCAACCCGCGTATCCAGGTCGAACATACCATCACCGAGGAGATTACGGGCATCGACATCGTGGCCGCCCAG
ATCCAGATCGCGGCCGGAGCGACGCTGGCCCAGCTCGGCCTGACGCAGGACCGCATCTCGACCCGCGGCTTTGCC
ATTCAGTGCCGCATCACCACCGAGGATCCGGCCAAGCTGTTCCAGCCCGACACGGGCAAGATCGAGGTCTACCGC
TCGGCTGGCGGCAACGGCGTCCGGCTGGACGGCGGGAATGGATTCGCCGGCGCCGTCATCACGCCCTTTTACGAC
TCCATGTTGGTCAAGTGTACGTGTCAGGGCTCGACGTACGAGATTGCCCGCAGAAAGGTGCTCCGAGCCCTGATC
GAGTTCCGCGTCCGGGGCGTCAAGACCAACATTCCCTTCCTGGCCTCGCTCCTGACGCACCCGACCTTCATCGAC
GGCAACTGCTGGACGACGTTCATCGATGACACGCCCCAGCTATTCGACCTGATCGGCGGTCAGAACCGAGCGCAG
AAGCTGCTGGCCTACCTGGGAGACGTGGCCGTCAACGGAAGCGCCATCAAGGGCCAGATAGGCGATCCCAAGTTC
AGGGGAGACATCATCCTCCCCATCATCTACGCGCCTGACGGCTCCAAAATCGACGTCAGCCAGCCTTGCCAGAAG
GGATGGCGTAACATTCTGGTCGAAAAGGGCCCCAAGGCCTTCGCCAAGGCCGTCCGTCAGTACAAGGGCTGTCTG
CTCATGGACACGACGTGGCGCGACGCCCATCAGTCGCTGCTGGCGACGCGCGTTCGGACCGTCGACCTGCTCAAC
ATCGCCAAGGAGACGAGCCACGCGCTGTCCAACCTGTACAGCCTCGAGTGCTGGGGCGGAGCCACGTTTGACGTG
GCCATGCGCTTCCTCTACGAGGATCCCTGGGATCGGCTCCGGCAGATGCGCAAACTCGTGCCCAACATCCCCTTC
CAGATGCTCCTCCGAGGGGCCAACGGTGTCGCCTACTCGTCGCTGCCCGACAACGCCATCGATCACTTCGTCGAC
CAGGCCAAGAAGAACGGCGTCGACATCTTCCGCGTCTTCGATGCCCTCAACGACATCGACCAGCTCGAGGTGGGC
ATCAAGGCGGTTCACAAGGCCGGCGGCGTGGCCGAGGGCACCGTCTGCTACAGCGGCGACATGCTCAACCCGGGC
AAGAAGTACAACCTGGAGTATTACATGGCCCTGGTCGACAAGCTCGTCAAGCTTGACATTCACGTGCTGGGCATC
AAGGATATGGCGGGCGTCCTGAAGCCACACGCGGCCACGCTGCTCATCGGGTCCATCCGCAAGAAGTATCCCGAC
CTCCCGATCCACGTACATACGCACGACTCGGCCGGCACGGGCGTCGCGTCCATGGTGGCCTGCGCCAAGGCCGGA
GCCGACGCGGTCGACGCGGCGACGGACAGCCTGTCGGGCATGACGTCGCAGCCCAGCATCAACGCCATCCTCGCC
TCGCTCGAAGGCAGCGATCTCGACCCCGGCCTCGACCCGAAACAGGTCCGGGCCCTCGACACGTACTGGTCCCAG
CTCCGGCTGCTGTACTCGCCCTTCGAGGCCCACCTCGCCGGACCGGACCCGGAGGTGTACGAGCACGAGATCCCG
GGAGGGCAGCTGACCAACATGATGTTCCAAGCTTCGCAGCTCGGCCTCGGCTCGCAGTGGCTGGAGACGAAGAAG
GCGTACGAACACGCCAACGACCTGCTCGGCGACATCGTCAAGGTGACGCCCACGTCCAAGGTGGTGGGCGACCTG
GCGCAGTTCATGGTGTCCAACAAGCTGTCGGCCGAAGACGTCAAGGCGAGGGCGTCGGAGCTCGACTTCCCCGGG
TCGGTGCTCGAGTTCCTCGAGGGCCTCATGGGCCAGCCCTACGGGGGGTTCCCCGAGCCGCTCCGGTCCGACGCG
CTGCGAGGGCGGCGGAAGCTCGACAAGCGGCCCGGGCTGTTCCTGGAGCCCGTGGACCTGGTCAAGGCCAAGAAG
GAGCTTCTCAAGAAGTTTGGCGGGCCGGTGACGGAGTGCGACGTGGCGTCGTACGTCATGTATCCCAAGGTGTTT
GAGGACTACAAGAAGTTCATGCAGCAGTACGGCGACCTGTCGGTGCTTCCGACCAAGTACTTCCTGTCGCGGCCG
GAGATTGGCGAGGAGTTCAACGTGCAGCTGGAGAAGGGCAAGGTGCTGATCCTGAAGCTGCTGGCCGTCGGCCCC
CTGAGCGAGAACACGGGCCAGCGCGAGGTGTTTTTCGAGATGAACGGCGAGGTGCGGCAGGTGACGGTGGTGGAC
AAGAAGGCGGCCGTCGAGAACGTGTGCCGTCCCAAGGCGGATCCGGGCGATTCGAGCCAGGTCGGGGCGCCCATG
TCGGGCGTTTTGGTGGAGATGAGGGTTCACGAGGGATCCGAGGTGAAGAAGGGAGATCCGCTGGCCGTGCTATCG
GCCATGAAGATGGAAATGGTCATCTCGGCTCCTCACAGCGGCAAGGTGGCGAGCCTCCAGGTCAAGGAGGGCGAC
TCGGTCGACGGGTCGGACCTGGTGTGCAGGATCACCAAGGCTTAA
Transcript >Ophun1|109
ATGTCGGTCCCTCAGCAGGCCCTCACCTTTAACGATGTCTTCGACGACGACGATATCGATGAGCCCAAGTCGGTG
CATCATATTCGCGCCAACTCGAGCATCATGCAACTCAAGAAGATCCTTGTTGCCAACCGTGGCGAAATTCCTATT
CGGATCTTCAGGACGGCCCATGAGCTATCGCTGCACACCATCGCCGTCTACAGTTACGAGGACCGTCTAAGCATG
CACCGCCAGAAGGCTGACGAGGCCTACGTCATCGGTCACCGCGGCCAGTATACCCCTGTCGGAGCCTATCTCGCC
GGCGATGAGATTATCAAGATCGCCCTCGAGCATGGCGCTCAACTAATCCACCCTGGCTACGGTTTCTTATCCGAG
AACGCCGAGTTCGCTCGCAATGTCGAAAAGGCCGGTCTTATTTTTGTTGGTCCGTCTCCTGAAGTCATCGACTCC
CTCGGCGACAAGGTATCGGCCCGCAAGCTGGCCATCGCCGCCGGCGTCCCCGTCGTGCCCGGAACCGAAGGCGCC
GTAGCCAAGTTCGAGGAAGTCGAGTCCTTTACCGACAAGTATGGCTTCCCCATCATCATCAAGGCAGCCTACGGT
GGCGGTGGTCGGGGCATGCGCGTCGTTCGTGATGCCGAAAGCCTGCAGGAGCATTTTGAGAGGGCCACGTCCGAG
GCCAAGTCGGCCTTTGGCAACGGCACCGTCTTCGTCGAGCGTTTCCTCGACAAGCCCAAGCACATCGAGGTTCAG
CTTCTGGGCGATAACCAGGGCAACATTGTTCATCTGTACGAGCGTGACTGCTCCGTTCAGCGCCGTCATCAAAAG
GTGGTCGAGATCGCCCCGGCCAAGGACCTCCCCACCGAGACGAGAGACGCCATCCTGGCCGACGCCGTCAAGCTG
GCCAAGTCGGTCAACTATCGCAACGCGGGCACGGCCGAGTTCCTGGTCGACCAGCAGAATCGATACTACTTCATC
GAGATCAACCCGCGTATCCAGGTCGAACATACCATCACCGAGGAGATTACGGGCATCGACATCGTGGCCGCCCAG
ATCCAGATCGCGGCCGGAGCGACGCTGGCCCAGCTCGGCCTGACGCAGGACCGCATCTCGACCCGCGGCTTTGCC
ATTCAGTGCCGCATCACCACCGAGGATCCGGCCAAGCTGTTCCAGCCCGACACGGGCAAGATCGAGGTCTACCGC
TCGGCTGGCGGCAACGGCGTCCGGCTGGACGGCGGGAATGGATTCGCCGGCGCCGTCATCACGCCCTTTTACGAC
TCCATGTTGGTCAAGTGTACGTGTCAGGGCTCGACGTACGAGATTGCCCGCAGAAAGGTGCTCCGAGCCCTGATC
GAGTTCCGCGTCCGGGGCGTCAAGACCAACATTCCCTTCCTGGCCTCGCTCCTGACGCACCCGACCTTCATCGAC
GGCAACTGCTGGACGACGTTCATCGATGACACGCCCCAGCTATTCGACCTGATCGGCGGTCAGAACCGAGCGCAG
AAGCTGCTGGCCTACCTGGGAGACGTGGCCGTCAACGGAAGCGCCATCAAGGGCCAGATAGGCGATCCCAAGTTC
AGGGGAGACATCATCCTCCCCATCATCTACGCGCCTGACGGCTCCAAAATCGACGTCAGCCAGCCTTGCCAGAAG
GGATGGCGTAACATTCTGGTCGAAAAGGGCCCCAAGGCCTTCGCCAAGGCCGTCCGTCAGTACAAGGGCTGTCTG
CTCATGGACACGACGTGGCGCGACGCCCATCAGTCGCTGCTGGCGACGCGCGTTCGGACCGTCGACCTGCTCAAC
ATCGCCAAGGAGACGAGCCACGCGCTGTCCAACCTGTACAGCCTCGAGTGCTGGGGCGGAGCCACGTTTGACGTG
GCCATGCGCTTCCTCTACGAGGATCCCTGGGATCGGCTCCGGCAGATGCGCAAACTCGTGCCCAACATCCCCTTC
CAGATGCTCCTCCGAGGGGCCAACGGTGTCGCCTACTCGTCGCTGCCCGACAACGCCATCGATCACTTCGTCGAC
CAGGCCAAGAAGAACGGCGTCGACATCTTCCGCGTCTTCGATGCCCTCAACGACATCGACCAGCTCGAGGTGGGC
ATCAAGGCGGTTCACAAGGCCGGCGGCGTGGCCGAGGGCACCGTCTGCTACAGCGGCGACATGCTCAACCCGGGC
AAGAAGTACAACCTGGAGTATTACATGGCCCTGGTCGACAAGCTCGTCAAGCTTGACATTCACGTGCTGGGCATC
AAGGATATGGCGGGCGTCCTGAAGCCACACGCGGCCACGCTGCTCATCGGGTCCATCCGCAAGAAGTATCCCGAC
CTCCCGATCCACGTACATACGCACGACTCGGCCGGCACGGGCGTCGCGTCCATGGTGGCCTGCGCCAAGGCCGGA
GCCGACGCGGTCGACGCGGCGACGGACAGCCTGTCGGGCATGACGTCGCAGCCCAGCATCAACGCCATCCTCGCC
TCGCTCGAAGGCAGCGATCTCGACCCCGGCCTCGACCCGAAACAGGTCCGGGCCCTCGACACGTACTGGTCCCAG
CTCCGGCTGCTGTACTCGCCCTTCGAGGCCCACCTCGCCGGACCGGACCCGGAGGTGTACGAGCACGAGATCCCG
GGAGGGCAGCTGACCAACATGATGTTCCAAGCTTCGCAGCTCGGCCTCGGCTCGCAGTGGCTGGAGACGAAGAAG
GCGTACGAACACGCCAACGACCTGCTCGGCGACATCGTCAAGGTGACGCCCACGTCCAAGGTGGTGGGCGACCTG
GCGCAGTTCATGGTGTCCAACAAGCTGTCGGCCGAAGACGTCAAGGCGAGGGCGTCGGAGCTCGACTTCCCCGGG
TCGGTGCTCGAGTTCCTCGAGGGCCTCATGGGCCAGCCCTACGGGGGGTTCCCCGAGCCGCTCCGGTCCGACGCG
CTGCGAGGGCGGCGGAAGCTCGACAAGCGGCCCGGGCTGTTCCTGGAGCCCGTGGACCTGGTCAAGGCCAAGAAG
GAGCTTCTCAAGAAGTTTGGCGGGCCGGTGACGGAGTGCGACGTGGCGTCGTACGTCATGTATCCCAAGGTGTTT
GAGGACTACAAGAAGTTCATGCAGCAGTACGGCGACCTGTCGGTGCTTCCGACCAAGTACTTCCTGTCGCGGCCG
GAGATTGGCGAGGAGTTCAACGTGCAGCTGGAGAAGGGCAAGGTGCTGATCCTGAAGCTGCTGGCCGTCGGCCCC
CTGAGCGAGAACACGGGCCAGCGCGAGGTGTTTTTCGAGATGAACGGCGAGGTGCGGCAGGTGACGGTGGTGGAC
AAGAAGGCGGCCGTCGAGAACGTGTGCCGTCCCAAGGCGGATCCGGGCGATTCGAGCCAGGTCGGGGCGCCCATG
TCGGGCGTTTTGGTGGAGATGAGGGTTCACGAGGGATCCGAGGTGAAGAAGGGAGATCCGCTGGCCGTGCTATCG
GCCATGAAGATGGAAATGGTCATCTCGGCTCCTCACAGCGGCAAGGTGGCGAGCCTCCAGGTCAAGGAGGGCGAC
TCGGTCGACGGGTCGGACCTGGTGTGCAGGATCACCAAGGCTTAA
Gene >Ophun1|109
ATGTCGGTCCCTCAGCAGGCCCTCACCTTTAACGATGTCTTCGACGACGACGATATCGATGAGCCCAAGTCGGTG
CATCATATTCGCGCCAACTCGAGCATCATGCAACTCAAGAAGATCCTTGGTGAGTTCCGTCATTTGCCATTCGGT
GAGCTGGGCTGACTGCTTCTCCTCTTCGCTTCAGTTGCCAACCGTGGCGAAATTCGTGAGTTTCTCCTCCGCCTC
TACCGTCTGATGCTGTTGCTAACTCCTGCAAGCTATTCGGGTACGACTCACTACCACTACCATCTCCATTATCCC
CCCCCCCCCCCTCCTCAAGATGCCGTGCTCACCGTCTCCGCCTTCGACAGATCTTCAGGACGGTACGTGACACCG
TCCGGCCTCTCATAACGCTCGTGCTGATAACCCCTCACCAGGCCCATGAGCTATCGCTGCACACCATCGCCGTCT
ACAGGTAACCTCATCCGAACAAGGTGCGACGCGGTCCAATAGCTGACGTTGGACCAAGTTACGAGGACCGTCTAA
GCATGCACCGCCAGAGTCTGTCCTCCGTTGCTGGATCCTCCGGTTACACAGCTGACCCTCCTTTATCTAGAGGCT
GACGAGGCCTACGTCATCGGTCACCGCGGCCAGTATACCCCTGTCGGAGCCTATCTCGCCGGCGATGAGATTATC
AAGATCGCCCTCGAGCATGGCGCTCAACTAATCCACCCTGGTAATTGGATCTAAGAATGCAACCTGTCTCGGCTA
CTAACGGCTTCCAGGCTACGGTTTCTTATCCGAGAACGCCGAGTTCGCTCGCAATGTCGAAAAGGCCGGTCTTAT
TGTGAGCTCTAGCAAGACGAGGCCTACTTGGATGCAGGCTGACCCGACGCCCAGTTTGTTGGTCCGTCTCCTGAA
GTCATCGACTCCCTCGGCGACAAGGTATCGGCCCGCAAGCTGGCCATCGCCGCCGGCGTCCCCGTCGTGCCCGGA
ACCGAAGGCGCCGTAGCCAAGTTCGAGGAAGTCGAGTCCTTTACCGACAAGTATGGCTTCCCCATCATCATCAAG
GCAGCCTACGGTGGCGGTGGTCGGGGCATGCGCGTCGTTCGTGATGCCGAAAGCCTGCAGGAGCATTTTGAGAGG
GCCACGTCCGAGGCCAAGTCGGCCTTTGGCAACGGCACCGTCTTCGTCGAGCGTTTCCTCGACAAGCCCAAGCAC
ATCGAGGTTCAGCTTCTGGGCGATAACCAGGGCAACATTGTTCATCTGTACGAGCGTGACTGCTCCGTTCAGCGC
CGTCATCAAAAGGTGGTCGAGATCGCCCCGGCCAAGGACCTCCCCACCGAGACGAGAGACGCCATCCTGGCCGAC
GCCGTCAAGCTGGCCAAGTCGGTCAACTATCGCAACGCGGGCACGGCCGAGTTCCTGGTCGACCAGCAGAATCGA
TACTACTTCATCGAGATCAACCCGCGTATCCAGGTCGAACATACCATCACCGAGGAGATTACGGGCATCGACATC
GTGGCCGCCCAGATCCAGATCGCGGCCGGAGCGACGCTGGCCCAGCTCGGCCTGACGCAGGACCGCATCTCGACC
CGCGGCTTTGCCATTCAGTGCCGCATCACCACCGAGGATCCGGCCAAGCTGTTCCAGCCCGACACGGGCAAGATC
GAGGTCTACCGCTCGGCTGGCGGCAACGGCGTCCGGCTGGACGGCGGGAATGGATTCGCCGGCGCCGTCATCACG
CCCTTTTACGACTCCATGTTGGTCAAGTGTACGTGTCAGGGCTCGACGTACGAGATTGCCCGCAGAAAGGTGCTC
CGAGCCCTGATCGAGTTCCGCGTCCGGGGCGTCAAGACCAACATTCCCTTCCTGGCCTCGCTCCTGACGCACCCG
ACCTTCATCGACGGCAACTGCTGGACGACGTTCATCGATGACACGCCCCAGCTATTCGACCTGATCGGCGGTCAG
AACCGAGCGCAGAAGCTGCTGGCCTACCTGGGAGACGTGGCCGTCAACGGAAGCGCCATCAAGGGCCAGATAGGC
GATCCCAAGTTCAGGGGAGACATCATCCTCCCCATCATCTACGCGCCTGACGGCTCCAAAATCGACGTCAGCCAG
CCTTGCCAGAAGGGATGGCGTAACATTCTGGTCGAAAAGGGCCCCAAGGCCTTCGCCAAGGCCGTCCGTCAGTAC
AAGGGCTGTCTGCTCATGGACACGACGTGGCGCGACGCCCATCAGTCGCTGCTGGCGACGCGCGTTCGGACCGTC
GACCTGCTCAACATCGCCAAGGAGACGAGCCACGCGCTGTCCAACCTGTACAGCCTCGAGTGCTGGGGCGGAGCC
ACGTTTGACGTGGCCATGCGCTTCCTCTACGAGGATCCCTGGGATCGGCTCCGGCAGATGCGCAAACTCGTGCCC
AACATCCCCTTCCAGATGCTCCTCCGAGGGGCCAACGGTGTCGCCTACTCGTCGCTGCCCGACAACGCCATCGAT
CACTTCGTCGACCAGGCCAAGAAGAACGGCGTCGACATCTTCCGCGTCTTCGATGCCCTCAACGACATCGACCAG
CTCGAGGTGGGCATCAAGGCGGTTCACAAGGCCGGCGGCGTGGCCGAGGGCACCGTCTGCTACAGCGGCGACATG
CTCAACCCGGGCAAGAAGTACAACCTGGAGTATTACATGGCCCTGGTCGACAAGCTCGTCAAGCTTGACATTCAC
GTGCTGGGCATCAAGGATATGGCGGGCGTCCTGAAGCCACACGCGGCCACGCTGCTCATCGGGTCCATCCGCAAG
AAGTATCCCGACCTCCCGATCCACGTACATACGCACGACTCGGCCGGCACGGGCGTCGCGTCCATGGTGGCCTGC
GCCAAGGCCGGAGCCGACGCGGTCGACGCGGCGACGGACAGCCTGTCGGGCATGACGTCGCAGCCCAGCATCAAC
GCCATCCTCGCCTCGCTCGAAGGCAGCGATCTCGACCCCGGCCTCGACCCGAAACAGGTCCGGGCCCTCGACACG
TACTGGTCCCAGCTCCGGCTGCTGTACTCGCCCTTCGAGGCCCACCTCGCCGGACCGGACCCGGAGGTGTACGAG
CACGAGATCCCGGGAGGGCAGCTGACCAACATGATGTTCCAAGCTTCGCAGCTCGGCCTCGGCTCGCAGTGGCTG
GAGACGAAGAAGGCGTACGAACACGCCAACGACCTGCTCGGCGACATCGTCAAGGTGACGCCCACGTCCAAGGTG
GTGGGCGACCTGGCGCAGTTCATGGTGTCCAACAAGCTGTCGGCCGAAGACGTCAAGGCGAGGGCGTCGGAGCTC
GACTTCCCCGGGTCGGTGCTCGAGTTCCTCGAGGGCCTCATGGGCCAGCCCTACGGGGGGTTCCCCGAGCCGCTC
CGGTCCGACGCGCTGCGAGGGCGGCGGAAGCTCGACAAGCGGCCCGGGCTGTTCCTGGAGCCCGTGGACCTGGTC
AAGGCCAAGAAGGAGCTTCTCAAGAAGTTTGGCGGGCCGGTGACGGAGTGCGACGTGGCGTCGTACGTCATGTAT
CCCAAGGTGTTTGAGGACTACAAGAAGTTCATGCAGCAGTACGGCGACCTGTCGGTGCTTCCGACCAAGTACTTC
CTGTCGCGGCCGGAGATTGGCGAGGAGTTCAACGTGCAGCTGGAGAAGGGCAAGGTGCTGATCCTGAAGCTGCTG
GCCGTCGGCCCCCTGAGCGAGAACACGGGCCAGCGCGAGGTGTTTTTCGAGATGAACGGCGAGGTGCGGCAGGTG
ACGGTGGTGGACAAGAAGGCGGCCGTCGAGAACGTGTGCCGTCCCAAGGCGGATCCGGGCGATTCGAGCCAGGTC
GGGGCGCCCATGTCGGGCGTTTTGGTGGAGATGAGGGTTCACGAGGGATCCGAGGTGAAGAAGGGAGATCCGCTG
GCCGTGCTATCGGCCATGAAGATGGTGAGCAAGAGGTGCCTGGAAGATGAGTCGACGTGGTTGCTAACCCTCTCA
GGAAATGGTCATCTCGGCTCCTCACAGCGGCAAGGTGGCGAGCCTCCAGGTCAAGGAGGGCGACTCGGTCGACGG
GTCGGACCTGGTGTGCAGGATCACCAAGGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail