Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1089
Gene name
LocationContig_1405:398..2066
Strand+
Gene length (bp)1668
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family 9.2E-44 117 327

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38830|NDT80_YEAST Meiosis-specific transcription factor NDT80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDT80 PE=1 SV=4 56 359 8.0E-10

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3107
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5819
Ophiocordyceps australis map64 (Brazil) OphauB2|1276
Ophiocordyceps camponoti-floridani Ophcf2|04064
Ophiocordyceps camponoti-rufipedis Ophun1|1089 (this protein)
Ophiocordyceps kimflemingae Ophio5|201
Ophiocordyceps subramaniannii Hirsu2|5413

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1089
MAHAHAQRTPAPHMGSQMAGLEPYSTVRRSSDHLSRSPAFPTGPLRRHHPSSLGSFAAAPRMDTGQYPARPPQLL
VPPLQPVQMLGVLNYIDSAMTPVKIDISGAVDKGPFLSYDHEWTCYRRNYLACVCSYTMSPHYFPNLPLQFTPSS
GSASGSASGPPFHVYGFAMCISAVVADNEGQSIDLVQHTPKRDKGPVNKPSKIPMAPKTGTPSHHHHHQQQHHHP
HHQHHHHQHTMNPYVEGPRGLYGADGLSAGQQLPAEHTFERIQFKHATLNNGKRRAAQQYYHLIVELWADVGTQA
TEQYVKVAYRKSAKMIVRGRSPGHYQNERRGSQGSSSGPGAGPTGSLTGYAAAMSPIPEYGGGGGGGNGGHSSAM
LSGAGAGGDGSSGGGTGGYATTGYDGRGGPGGGAGGGPGAGSGPGAGVYGSSRPQQQHDMTDDSVLPPQADDGKS
LDGPKSYQLYQGSAYDAHHDRVDLFGSHREGGLPSMTSDSSKVKNELDFNTMLPRPFHTSSSTTSRLGDHQRSAH
EHYDGGGKASSGAYYPSLVSSSTGIHMTMA*
Coding >Ophun1|1089
ATGGCCCACGCTCACGCCCAGCGTACGCCAGCACCGCACATGGGCTCGCAGATGGCCGGCCTCGAGCCCTACTCG
ACCGTCCGACGGAGCTCCGATCATCTCTCCCGCTCGCCGGCCTTTCCGACGGGGCCCCTGCGTCGTCATCATCCT
TCCTCGCTCGGGAGCTTCGCTGCTGCCCCGAGGATGGACACGGGCCAGTATCCGGCTCGGCCTCCGCAGCTGCTG
GTGCCTCCCCTGCAGCCGGTTCAGATGCTGGGCGTCCTCAACTACATCGACTCGGCCATGACGCCCGTCAAGATC
GACATCTCGGGCGCCGTCGATAAGGGGCCCTTTCTGTCGTACGACCACGAGTGGACGTGTTACCGCCGCAATTAT
CTGGCCTGCGTCTGCTCCTATACCATGAGTCCGCATTACTTCCCCAACTTGCCGCTGCAGTTTACGCCCTCGTCC
GGCTCCGCGTCCGGTTCAGCCTCCGGTCCGCCCTTTCACGTCTACGGCTTTGCCATGTGTATCTCGGCCGTCGTG
GCGGACAACGAGGGCCAGAGCATTGATCTGGTTCAGCACACGCCCAAGCGGGATAAGGGTCCCGTCAATAAGCCG
TCCAAGATCCCCATGGCGCCCAAGACGGGCACTCCGTCACATCATCATCACCACCAACAGCAACATCACCATCCT
CATCATCAACACCACCACCATCAGCACACCATGAATCCCTACGTCGAAGGCCCCCGCGGTCTCTACGGAGCTGAC
GGTCTCTCCGCCGGCCAGCAGCTACCGGCCGAGCACACCTTTGAGCGAATCCAGTTCAAGCACGCGACTCTCAAC
AACGGCAAGCGACGCGCCGCCCAGCAGTACTATCACCTCATCGTCGAGCTGTGGGCCGACGTCGGAACTCAGGCA
ACCGAGCAGTACGTCAAGGTGGCCTACCGCAAGTCGGCCAAGATGATTGTCCGCGGCCGTTCGCCGGGACACTAT
CAGAACGAGAGACGCGGCAGTCAGGGGAGCAGCAGCGGGCCCGGAGCCGGCCCTACCGGTAGTCTAACCGGATAT
GCCGCTGCCATGAGCCCGATCCCGGAGTACGGCGGCGGTGGCGGCGGAGGCAACGGGGGCCATTCTTCCGCCATG
CTCAGCGGAGCCGGAGCCGGCGGAGATGGCAGCAGTGGCGGTGGTACCGGAGGATACGCCACGACGGGGTATGAT
GGCCGTGGAGGACCGGGAGGCGGTGCCGGAGGAGGTCCCGGGGCGGGGTCCGGACCCGGAGCCGGAGTCTACGGC
AGCTCTCGACCTCAGCAACAGCACGACATGACGGACGACTCGGTTCTTCCCCCGCAAGCCGACGACGGAAAGTCC
CTCGACGGTCCCAAGAGCTATCAGCTCTATCAGGGCTCGGCCTACGATGCCCACCACGACCGCGTCGATCTCTTC
GGCAGCCATCGAGAAGGCGGCCTCCCAAGCATGACGTCCGACTCATCCAAGGTGAAGAATGAGCTCGACTTTAAC
ACCATGTTGCCTCGACCCTTCCACACCTCGTCTTCTACCACATCCCGTCTTGGCGACCATCAGCGTTCGGCACAC
GAGCATTACGATGGGGGCGGCAAGGCCTCGTCTGGGGCTTACTATCCTTCTCTGGTTTCCTCGTCTACAGGCATT
CACATGACTATGGCGTGA
Transcript >Ophun1|1089
ATGGCCCACGCTCACGCCCAGCGTACGCCAGCACCGCACATGGGCTCGCAGATGGCCGGCCTCGAGCCCTACTCG
ACCGTCCGACGGAGCTCCGATCATCTCTCCCGCTCGCCGGCCTTTCCGACGGGGCCCCTGCGTCGTCATCATCCT
TCCTCGCTCGGGAGCTTCGCTGCTGCCCCGAGGATGGACACGGGCCAGTATCCGGCTCGGCCTCCGCAGCTGCTG
GTGCCTCCCCTGCAGCCGGTTCAGATGCTGGGCGTCCTCAACTACATCGACTCGGCCATGACGCCCGTCAAGATC
GACATCTCGGGCGCCGTCGATAAGGGGCCCTTTCTGTCGTACGACCACGAGTGGACGTGTTACCGCCGCAATTAT
CTGGCCTGCGTCTGCTCCTATACCATGAGTCCGCATTACTTCCCCAACTTGCCGCTGCAGTTTACGCCCTCGTCC
GGCTCCGCGTCCGGTTCAGCCTCCGGTCCGCCCTTTCACGTCTACGGCTTTGCCATGTGTATCTCGGCCGTCGTG
GCGGACAACGAGGGCCAGAGCATTGATCTGGTTCAGCACACGCCCAAGCGGGATAAGGGTCCCGTCAATAAGCCG
TCCAAGATCCCCATGGCGCCCAAGACGGGCACTCCGTCACATCATCATCACCACCAACAGCAACATCACCATCCT
CATCATCAACACCACCACCATCAGCACACCATGAATCCCTACGTCGAAGGCCCCCGCGGTCTCTACGGAGCTGAC
GGTCTCTCCGCCGGCCAGCAGCTACCGGCCGAGCACACCTTTGAGCGAATCCAGTTCAAGCACGCGACTCTCAAC
AACGGCAAGCGACGCGCCGCCCAGCAGTACTATCACCTCATCGTCGAGCTGTGGGCCGACGTCGGAACTCAGGCA
ACCGAGCAGTACGTCAAGGTGGCCTACCGCAAGTCGGCCAAGATGATTGTCCGCGGCCGTTCGCCGGGACACTAT
CAGAACGAGAGACGCGGCAGTCAGGGGAGCAGCAGCGGGCCCGGAGCCGGCCCTACCGGTAGTCTAACCGGATAT
GCCGCTGCCATGAGCCCGATCCCGGAGTACGGCGGCGGTGGCGGCGGAGGCAACGGGGGCCATTCTTCCGCCATG
CTCAGCGGAGCCGGAGCCGGCGGAGATGGCAGCAGTGGCGGTGGTACCGGAGGATACGCCACGACGGGGTATGAT
GGCCGTGGAGGACCGGGAGGCGGTGCCGGAGGAGGTCCCGGGGCGGGGTCCGGACCCGGAGCCGGAGTCTACGGC
AGCTCTCGACCTCAGCAACAGCACGACATGACGGACGACTCGGTTCTTCCCCCGCAAGCCGACGACGGAAAGTCC
CTCGACGGTCCCAAGAGCTATCAGCTCTATCAGGGCTCGGCCTACGATGCCCACCACGACCGCGTCGATCTCTTC
GGCAGCCATCGAGAAGGCGGCCTCCCAAGCATGACGTCCGACTCATCCAAGGTGAAGAATGAGCTCGACTTTAAC
ACCATGTTGCCTCGACCCTTCCACACCTCGTCTTCTACCACATCCCGTCTTGGCGACCATCAGCGTTCGGCACAC
GAGCATTACGATGGGGGCGGCAAGGCCTCGTCTGGGGCTTACTATCCTTCTCTGGTTTCCTCGTCTACAGGCATT
CACATGACTATGGCGTGA
Gene >Ophun1|1089
ATGGCCCACGCTCACGCCCAGCGTACGCCAGCACCGCACATGGGCTCGCAGATGGCCGGCCTCGAGCCCTACTCG
ACCGTCCGACGGAGCTCCGATCATCTCTCCCGCTCGCCGGCCTTTCCGACGGGGCCCCTGCGTCGTCATCATCCT
TCCTCGCTCGGGAGCTTCGCTGCTGCCCCGAGGATGGACACGGGCCAGTATCCGGCTCGGCCTCCGCAGCTGCTG
GTGCCTCCCCTGCAGCCGGTTCAGATGCTGGGCGTCCTCAACTACATCGACTCGGCCATGACGCCCGTCAAGATC
GACATCTCGGGCGCCGTCGATAAGGGGCCCTTTCTGTCGTACGACCACGAGTGGACGTGTTACCGCCGCAATTAT
CTGGCCTGCGTCTGCTCCTATACCATGAGTCCGCATTACTTCCCCAACTTGCCGCTGCAGTTTACGCCCTCGTCC
GGCTCCGCGTCCGGTTCAGCCTCCGGTCCGCCCTTTCACGTCTACGGCTTTGCCATGTGTATCTCGGCCGTCGTG
GCGGACAACGAGGGCCAGAGCATTGATCTGGTTCAGCACACGCCCAAGCGGGATAAGGGTCCCGTCAATAAGCCG
TCCAAGATCCCCATGGCGCCCAAGACGGGCACTCCGTCACATCATCATCACCACCAACAGCAACATCACCATCCT
CATCATCAACACCACCACCATCAGCACACCATGAATCCCTACGTCGAAGGCCCCCGCGGTCTCTACGGAGCTGAC
GGTCTCTCCGCCGGCCAGCAGCTACCGGCCGAGCACACCTTTGAGCGAATCCAGTTCAAGCACGCGACTCTCAAC
AACGGCAAGCGACGCGCCGCCCAGCAGTACTATCACCTCATCGTCGAGCTGTGGGCCGACGTCGGAACTCAGGCA
ACCGAGCAGTACGTCAAGGTGGCCTACCGCAAGTCGGCCAAGATGATTGTCCGCGGCCGTTCGCCGGGACACTAT
CAGAACGAGAGACGCGGCAGTCAGGGGAGCAGCAGCGGGCCCGGAGCCGGCCCTACCGGTAGTCTAACCGGATAT
GCCGCTGCCATGAGCCCGATCCCGGAGTACGGCGGCGGTGGCGGCGGAGGCAACGGGGGCCATTCTTCCGCCATG
CTCAGCGGAGCCGGAGCCGGCGGAGATGGCAGCAGTGGCGGTGGTACCGGAGGATACGCCACGACGGGGTATGAT
GGCCGTGGAGGACCGGGAGGCGGTGCCGGAGGAGGTCCCGGGGCGGGGTCCGGACCCGGAGCCGGAGTCTACGGC
AGCTCTCGACCTCAGCAACAGCACGACATGACGGACGACTCGGTTCTTCCCCCGCAAGCCGACGACGGAAAGTCC
CTCGACGGTCCCAAGAGCTATCAGCTCTATCAGGGCTCGGCCTACGATGCCCACCACGACCGCGTCGATCTCTTC
GGCAGCCATCGAGAAGGCGGCCTCCCAAGCATGACGTCCGACTCATCCAAGGTGAAGAATGAGCTCGACTTTAAC
ACCATGTTGCCTCGACCCTTCCACACCTCGTCTTCTACCACATCCCGTCTTGGCGACCATCAGCGTTCGGCACAC
GAGCATTACGATGGGGGCGGCAAGGCCTCGTCTGGGGCTTACTATCCTTCTCTGGTTTCCTCGTCTACAGGCATT
CACATGACTATGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail