Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1073
Gene name
LocationContig_14:71528..73147
Strand-
Gene length (bp)1619
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00465 Fe-ADH Iron-containing alcohol dehydrogenase 4.5E-101 67 464
PF13685 Fe-ADH_2 Iron-containing alcohol dehydrogenase 1.0E-11 71 164

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6P371|HOT_XENTR Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus tropicalis GN=adhfe1 PE=2 SV=1 13 485 2.0E-162
sp|A6QP15|HOT_BOVIN Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Bos taurus GN=ADHFE1 PE=2 SV=1 10 485 9.0E-162
sp|Q4QQW3|HOT_RAT Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Rattus norvegicus GN=Adhfe1 PE=1 SV=1 10 485 1.0E-159
sp|Q08B39|HOT_XENLA Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus laevis GN=adhfe1 PE=2 SV=1 17 485 2.0E-159
sp|Q8R0N6|HOT_MOUSE Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Mus musculus GN=Adhfe1 PE=1 SV=2 10 485 3.0E-159
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6P371|HOT_XENTR Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus tropicalis GN=adhfe1 PE=2 SV=1 13 485 2.0E-162
sp|A6QP15|HOT_BOVIN Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Bos taurus GN=ADHFE1 PE=2 SV=1 10 485 9.0E-162
sp|Q4QQW3|HOT_RAT Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Rattus norvegicus GN=Adhfe1 PE=1 SV=1 10 485 1.0E-159
sp|Q08B39|HOT_XENLA Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus laevis GN=adhfe1 PE=2 SV=1 17 485 2.0E-159
sp|Q8R0N6|HOT_MOUSE Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Mus musculus GN=Adhfe1 PE=1 SV=2 10 485 3.0E-159
sp|Q5RF11|HOT_PONAB Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Pongo abelii GN=ADHFE1 PE=2 SV=1 14 485 1.0E-157
sp|Q8IWW8|HOT_HUMAN Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Homo sapiens GN=ADHFE1 PE=1 SV=1 18 485 4.0E-156
sp|Q17EN4|HOT_AEDAE Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Aedes aegypti GN=AAEL003729 PE=3 SV=1 36 486 3.0E-154
sp|Q7Q547|HOT_ANOGA Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Anopheles gambiae GN=AGAP006646 PE=3 SV=3 14 486 6.0E-153
sp|Q28XT3|HOT_DROPS Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA17444 PE=3 SV=2 17 485 3.0E-145
sp|Q9W265|HOT_DROME Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Drosophila melanogaster GN=T3dh PE=2 SV=1 18 485 1.0E-144
sp|A8WTJ7|HOT_CAEBR Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Caenorhabditis briggsae GN=CBG02769 PE=3 SV=1 30 486 2.0E-135
sp|Q9U2M4|HOT_CAEEL Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Caenorhabditis elegans GN=Y38F1A.6 PE=3 SV=1 15 486 3.0E-133
sp|Q54GJ7|HOT_DICDI Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Dictyostelium discoideum GN=adhfe1 PE=3 SV=1 58 486 3.0E-130
sp|P31005|MEDH_BACMT NAD-dependent methanol dehydrogenase OS=Bacillus methanolicus GN=mdh PE=1 SV=3 71 449 9.0E-44
sp|A4IP64|ADH1_GEOTN Long-chain-alcohol dehydrogenase 1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=adh1 PE=1 SV=1 72 486 7.0E-41
sp|P76553|EUTG_ECOLI Ethanolamine utilization protein EutG OS=Escherichia coli (strain K12) GN=eutG PE=3 SV=2 72 430 5.0E-37
sp|P0DJA2|ADH2_ZYMMO Alcohol dehydrogenase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adhB PE=1 SV=1 70 474 2.0E-36
sp|F8DVL8|ADH2_ZYMMA Alcohol dehydrogenase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=adhB PE=3 SV=1 70 474 6.0E-36
sp|Q59477|DHAT_KLEPN 1,3-propanediol dehydrogenase OS=Klebsiella pneumoniae GN=dhaT PE=1 SV=1 57 440 9.0E-36
sp|P41795|EUTG_SALTY Ethanolamine utilization protein EutG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=eutG PE=3 SV=2 72 454 2.0E-34
sp|P45513|DHAT_CITFR 1,3-propanediol dehydrogenase OS=Citrobacter freundii GN=dhaT PE=3 SV=1 57 440 4.0E-34
sp|P37686|ADH2_ECOLI Probable alcohol dehydrogenase OS=Escherichia coli (strain K12) GN=yiaY PE=3 SV=4 64 485 5.0E-33
sp|Q09669|ADH4_SCHPO Alcohol dehydrogenase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adh4 PE=2 SV=1 48 485 1.0E-32
sp|P0A9S1|FUCO_ECOLI Lactaldehyde reductase OS=Escherichia coli (strain K12) GN=fucO PE=1 SV=2 71 454 3.0E-32
sp|P0A9S2|FUCO_ECO57 Lactaldehyde reductase OS=Escherichia coli O157:H7 GN=fucO PE=3 SV=2 71 454 3.0E-32
sp|P71017|GBSB_BACSU Alcohol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gbsB PE=1 SV=2 60 449 4.0E-32
sp|P13604|ADH1_CLOSA NADPH-dependent butanol dehydrogenase OS=Clostridium saccharobutylicum GN=adh1 PE=3 SV=1 69 482 1.0E-28
sp|Q04944|ADHA_CLOAB NADH-dependent butanol dehydrogenase A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bdhA PE=1 SV=2 67 449 2.0E-28
sp|P38945|4HDB_CLOK5 NAD-dependent 4-hydroxybutyrate dehydrogenase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=4hbD PE=3 SV=1 128 461 2.0E-28
sp|Q24803|ADH2_ENTHI Aldehyde-alcohol dehydrogenase 2 OS=Entamoeba histolytica GN=ADH2 PE=1 SV=1 68 387 2.0E-26
sp|P10127|ADH4_YEAST Alcohol dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH4 PE=1 SV=3 71 469 4.0E-26
sp|A6ZTT5|ADH4_YEAS7 Alcohol dehydrogenase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=ADH4 PE=3 SV=2 71 469 5.0E-26
sp|P0A9Q7|ADHE_ECOLI Aldehyde-alcohol dehydrogenase OS=Escherichia coli (strain K12) GN=adhE PE=1 SV=2 87 395 5.0E-24
sp|P0A9Q8|ADHE_ECO57 Aldehyde-alcohol dehydrogenase OS=Escherichia coli O157:H7 GN=adhE PE=3 SV=2 87 395 5.0E-24
sp|P33744|ADHE_CLOAB Aldehyde-alcohol dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=adhE PE=2 SV=3 90 395 1.0E-22
sp|Q04945|ADHB_CLOAB NADH-dependent butanol dehydrogenase B OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bdhB PE=1 SV=1 67 454 8.0E-22
sp|Q9F282|ADHA_THEET Long-chain primary alcohol dehydrogenase AdhA OS=Thermoanaerobacter ethanolicus GN=adhA PE=1 SV=1 62 450 5.0E-21
sp|O05239|YUGJ_BACSU Probable NADH-dependent butanol dehydrogenase 1 OS=Bacillus subtilis (strain 168) GN=yugJ PE=3 SV=1 67 467 3.0E-19
sp|C5MRT8|MNO_MYCS8 Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase OS=Mycobacterium sp. (strain DSM 3803 / JC1) PE=1 SV=1 71 409 2.0E-18
sp|Q9RCG0|MNO_AMYME Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase OS=Amycolatopsis methanolica GN=mno PE=1 SV=1 71 405 3.0E-18
sp|Q53062|MNO_RHOER Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase OS=Rhodococcus erythropolis GN=thcE PE=1 SV=2 71 409 4.0E-17
sp|Q24857|ADH3_ENTHI Alcohol dehydrogenase 3 OS=Entamoeba histolytica GN=ADH3 PE=2 SV=1 122 449 1.0E-15
sp|O05240|YUGK_BACSU Probable NADH-dependent butanol dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=yugK PE=3 SV=1 67 451 3.0E-15
sp|Q46856|YQHD_ECOLI Alcohol dehydrogenase YqhD OS=Escherichia coli (strain K12) GN=yqhD PE=1 SV=1 88 451 4.0E-15
sp|A4ISB9|ADH2_GEOTN Long-chain-alcohol dehydrogenase 2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=adh2 PE=1 SV=1 57 451 1.0E-14
sp|Q93T12|TFDF_DELAC Maleylacetate reductase OS=Delftia acidovorans GN=tfdF PE=1 SV=2 69 388 1.0E-14
sp|P27101|TCBF_PSESQ Maleylacetate reductase OS=Pseudomonas sp. (strain P51) GN=tcbF PE=3 SV=1 69 388 1.0E-14
sp|P94135|TFDF2_CUPPJ Maleylacetate reductase 2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFII PE=1 SV=1 55 392 3.0E-12
sp|O30847|CLCE_PSEKB Maleylacetate reductase OS=Pseudomonas knackmussii (strain DSM 6978 / LMG 23759 / B13) GN=clcE PE=3 SV=1 71 447 6.0E-11
sp|O87612|CLCE_PSEAI Maleylacetate reductase OS=Pseudomonas aeruginosa GN=clcE PE=3 SV=1 71 447 1.0E-10
sp|P27137|TFDF1_CUPPJ Maleylacetate reductase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFI PE=3 SV=1 57 400 1.0E-08
sp|O84992|MACA1_RHOOP Maleylacetate reductase 1 OS=Rhodococcus opacus GN=macA PE=3 SV=1 54 404 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5514
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5729
Ophiocordyceps australis map64 (Brazil) OphauB2|877
Ophiocordyceps camponoti-floridani Ophcf2|01382
Ophiocordyceps camponoti-rufipedis Ophun1|1073 (this protein)
Ophiocordyceps kimflemingae Ophio5|5497
Ophiocordyceps subramaniannii Hirsu2|6777

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1073
MTALVRAIPSAANRAANLLRTIQFAHPPTCPCHGVTGGSPSPVAGRRRHGGSSAGQMSEYAFEMAASSIRFGPGV
TREVGMDLHNLGARRVAVVTDATVDKLDAMRQVREALVAESISFDVYSGVRVEPKDSSIKEAIAWARPYRPDVFV
AVGGGSVIDTAKLMNLYSAYPDADFLDFVNAPLGKGRPVDKPLRPLIAIPTTAGTGSETTGTAIFDLVAERAKTG
VAHRNLKPTLGICDPLNTRTMPAAVKASSGLDVLCHSLESWTAIPYNQRTPRPTNPLLRPAYQGANPISDVFSFH
ALCRTIKYLPRAIKDPDDFEAQSEMLLASTLAGVGFGNAGVHLCHGMSYPISGQNPGYRHAGYQVSSPLIPHGVS
VAVTAPAVFRFTAASNPERHLQAAAAFGVDVSNVKRESAGEVLAEALTKFLAELGDQPGGLKELGFGAEHIDALV
EGTIPQARVLTLAPGLSKELEVEREQLRRLFEDAMSH*
Coding >Ophun1|1073
ATGACCGCCCTCGTTCGAGCCATCCCCAGCGCCGCCAATCGAGCCGCCAACCTCCTGCGGACCATCCAGTTCGCG
CACCCGCCGACCTGCCCGTGCCACGGCGTCACCGGGGGATCCCCGTCTCCCGTCGCCGGCCGTCGTCGTCATGGC
GGCTCGTCCGCCGGTCAGATGTCCGAGTATGCCTTCGAGATGGCGGCCTCGTCTATTCGCTTCGGGCCCGGCGTC
ACGCGAGAGGTCGGCATGGACCTTCACAACTTGGGCGCCAGGCGCGTTGCCGTAGTTACCGATGCCACCGTCGAC
AAGCTCGATGCCATGCGGCAGGTCCGCGAAGCTCTTGTGGCCGAGAGCATCAGCTTCGACGTCTACTCAGGCGTG
CGGGTCGAGCCCAAGGATAGCTCCATCAAGGAGGCCATAGCGTGGGCGAGGCCGTACCGTCCAGACGTCTTCGTC
GCCGTTGGCGGAGGCTCCGTCATCGACACGGCCAAGCTCATGAATCTCTATTCCGCCTATCCAGACGCCGACTTT
CTCGACTTTGTCAACGCGCCTCTCGGAAAGGGCCGACCCGTCGACAAGCCACTCCGGCCTCTCATCGCCATCCCG
ACCACGGCCGGCACCGGTAGCGAGACGACCGGAACCGCCATCTTCGACCTCGTGGCCGAGCGCGCAAAGACGGGT
GTCGCCCACCGGAACCTCAAGCCCACCCTCGGCATCTGCGATCCCCTCAACACCCGAACCATGCCGGCCGCCGTC
AAGGCGAGTTCGGGCCTCGACGTCCTCTGCCACTCGCTCGAGTCGTGGACCGCCATACCCTACAATCAGAGAACG
CCGCGGCCGACAAACCCTTTGTTGCGGCCTGCCTACCAGGGGGCCAATCCCATCTCCGACGTCTTCTCTTTCCAC
GCCCTTTGCAGGACCATCAAGTACCTGCCCCGCGCCATCAAGGACCCTGACGACTTCGAGGCCCAGAGCGAGATG
CTGCTAGCCTCTACCTTGGCCGGTGTAGGCTTTGGCAATGCCGGCGTGCACTTGTGCCACGGCATGTCGTACCCC
ATTTCGGGCCAGAACCCGGGATACAGGCACGCGGGCTATCAGGTGTCATCACCCCTGATTCCACATGGCGTCTCC
GTCGCCGTCACTGCCCCGGCCGTCTTTAGATTCACGGCCGCATCCAATCCGGAGCGACATTTGCAGGCTGCCGCG
GCATTCGGCGTCGACGTCTCCAACGTCAAGAGAGAGAGCGCAGGCGAGGTTCTGGCCGAGGCACTGACCAAATTT
CTCGCCGAGCTGGGCGACCAGCCGGGGGGTCTCAAGGAGTTGGGTTTCGGCGCCGAGCACATTGACGCTCTCGTC
GAAGGCACCATTCCCCAGGCGCGCGTGCTGACGCTGGCACCCGGACTCTCGAAGGAGCTCGAGGTCGAAAGGGAA
CAGCTGCGACGGCTGTTTGAGGACGCAATGAGCCACTGA
Transcript >Ophun1|1073
ATGACCGCCCTCGTTCGAGCCATCCCCAGCGCCGCCAATCGAGCCGCCAACCTCCTGCGGACCATCCAGTTCGCG
CACCCGCCGACCTGCCCGTGCCACGGCGTCACCGGGGGATCCCCGTCTCCCGTCGCCGGCCGTCGTCGTCATGGC
GGCTCGTCCGCCGGTCAGATGTCCGAGTATGCCTTCGAGATGGCGGCCTCGTCTATTCGCTTCGGGCCCGGCGTC
ACGCGAGAGGTCGGCATGGACCTTCACAACTTGGGCGCCAGGCGCGTTGCCGTAGTTACCGATGCCACCGTCGAC
AAGCTCGATGCCATGCGGCAGGTCCGCGAAGCTCTTGTGGCCGAGAGCATCAGCTTCGACGTCTACTCAGGCGTG
CGGGTCGAGCCCAAGGATAGCTCCATCAAGGAGGCCATAGCGTGGGCGAGGCCGTACCGTCCAGACGTCTTCGTC
GCCGTTGGCGGAGGCTCCGTCATCGACACGGCCAAGCTCATGAATCTCTATTCCGCCTATCCAGACGCCGACTTT
CTCGACTTTGTCAACGCGCCTCTCGGAAAGGGCCGACCCGTCGACAAGCCACTCCGGCCTCTCATCGCCATCCCG
ACCACGGCCGGCACCGGTAGCGAGACGACCGGAACCGCCATCTTCGACCTCGTGGCCGAGCGCGCAAAGACGGGT
GTCGCCCACCGGAACCTCAAGCCCACCCTCGGCATCTGCGATCCCCTCAACACCCGAACCATGCCGGCCGCCGTC
AAGGCGAGTTCGGGCCTCGACGTCCTCTGCCACTCGCTCGAGTCGTGGACCGCCATACCCTACAATCAGAGAACG
CCGCGGCCGACAAACCCTTTGTTGCGGCCTGCCTACCAGGGGGCCAATCCCATCTCCGACGTCTTCTCTTTCCAC
GCCCTTTGCAGGACCATCAAGTACCTGCCCCGCGCCATCAAGGACCCTGACGACTTCGAGGCCCAGAGCGAGATG
CTGCTAGCCTCTACCTTGGCCGGTGTAGGCTTTGGCAATGCCGGCGTGCACTTGTGCCACGGCATGTCGTACCCC
ATTTCGGGCCAGAACCCGGGATACAGGCACGCGGGCTATCAGGTGTCATCACCCCTGATTCCACATGGCGTCTCC
GTCGCCGTCACTGCCCCGGCCGTCTTTAGATTCACGGCCGCATCCAATCCGGAGCGACATTTGCAGGCTGCCGCG
GCATTCGGCGTCGACGTCTCCAACGTCAAGAGAGAGAGCGCAGGCGAGGTTCTGGCCGAGGCACTGACCAAATTT
CTCGCCGAGCTGGGCGACCAGCCGGGGGGTCTCAAGGAGTTGGGTTTCGGCGCCGAGCACATTGACGCTCTCGTC
GAAGGCACCATTCCCCAGGCGCGCGTGCTGACGCTGGCACCCGGACTCTCGAAGGAGCTCGAGGTCGAAAGGGAA
CAGCTGCGACGGCTGTTTGAGGACGCAATGAGCCACTGA
Gene >Ophun1|1073
ATGACCGCCCTCGTTCGAGCCATCCCCAGCGTACCTACGAGCCAGCTCCTGTCCTAGACTGCCGCTGACGTCGAA
GAGAGACAGGCCGCCAATCGAGCCGCCAACCTCCTGCGGACCATCCAGTTCGCGCACCCGCCGACCTGCCCGTGC
CACGGCGTCACCGGGGGATCCCCGTCTCCCGTCGCCGGCCGTCGTCGTCATGGCGGCTCGTCCGCCGGTCAGATG
TCCGAGTATGCCTTCGAGATGGCGGCCTCGTCTATTCGCTTCGGGCCCGGCGTCACGCGAGAGGTCGGCATGGAC
CTTCACAACTTGGGCGCCAGGCGCGTTGCCGTAGTTACCGATGCCACCGTCGACAAGCTCGATGCCATGCGGCAG
GTCCGCGAAGCTCTTGTGGCCGAGAGCATCAGCTTCGACGTCTACTCAGGCGTGCGGGTCGAGCCCAAGGATAGC
TCGTACGTCGTCCCCCCGATATCCGACGCCTCAGCTCACGCGCCAGCGACGCAGCATCAAGGAGGCCATAGCGTG
GGCGAGGCCGTACCGTCCAGACGTCTTCGTCGCCGTTGGCGGAGGCTCCGTCATCGACACGGCCAAGCTCATGAA
TCTCTATTCCGCCTATCCAGACGCCGACTTTCTCGACTTTGTCAACGCGCCTCTCGGAAAGGGCCGACCCGTCGA
CAAGCCACTCCGGCCTCTCATCGCCATCCCGACCACGGCCGGCACCGGTAGCGAGACGACCGGAACCGCCATCTT
CGACCTCGTGGCCGAGCGCGCAAAGACGGGTGTCGCCCACCGGAACCTCAAGCCCACCCTCGGCATCTGCGATCC
CCTCAACACCCGAACCATGCCGGCCGCCGTCAAGGCGAGTTCGGGCCTCGACGTCCTCTGCCACTCGCTCGAGTC
GTGGACCGCCATACCCTACAATCAGAGAACGCCGCGGCCGACAAACCCTTTGTTGCGGCCTGCCTACCAGGGGGC
CAATCCCATCTCCGACGTCTTCTCTTTCCACGCCCTTTGCAGGACCATCAAGTACCTGCCCCGCGCCATCAAGGA
CCCTGACGACTTCGAGGCCCAGAGCGAGATGCTGCTAGCCTCTACCTTGGCCGGTGTAGGCTTTGGCAATGCCGG
CGTGCACTTGTGCCACGGTTGGTCTCCTTTCATGGTCGGCGCGGGACGTTGAAGCTCACTGCACAGGCATGTCGT
ACCCCATTTCGGGCCAGAACCCGGGATACAGGCACGCGGGCTATCAGGTGTCATCACCCCTGATTCCACATGGCG
TCTCCGTCGCCGTCACTGCCCCGGCCGTCTTTAGATTCACGGCCGCATCCAATCCGGAGCGACATTTGCAGGCTG
CCGCGGCATTCGGCGTCGACGTCTCCAACGTCAAGAGAGAGAGCGCAGGCGAGGTTCTGGCCGAGGCACTGACCA
AATTTCTCGCCGAGCTGGGCGACCAGCCGGGGGGTCTCAAGGAGTTGGGTTTCGGCGCCGAGCACATTGACGCTC
TCGTCGAAGGCACCATTCCCCAGGCGCGCGTGCTGACGCTGGCACCCGGACTCTCGAAGGAGCTCGAGGTCGAAA
GGGAACAGCTGCGACGGCTGTTTGAGGACGCAATGAGCCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail