Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1055
Gene name
LocationContig_14:29705..30882
Strand-
Gene length (bp)1177
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04695 Pex14_N Pex14 N-terminal domain 4.5E-16 4 48

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78723|PEX14_PICAN Peroxisomal membrane protein PER10 OS=Pichia angusta GN=PEX14 PE=3 SV=1 4 321 7.0E-42
sp|Q9HG09|PEX14_PICPA Peroxisomal membrane protein PEX14 OS=Komagataella pastoris GN=PEX14 PE=1 SV=1 2 268 2.0E-38
sp|P53112|PEX14_YEAST Peroxisomal membrane protein PEX14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX14 PE=1 SV=1 4 323 2.0E-32
sp|O60065|PEX14_SCHPO Peroxisomal membrane protein pex14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex14 PE=3 SV=1 3 322 3.0E-28
sp|Q9R0A0|PEX14_MOUSE Peroxisomal membrane protein PEX14 OS=Mus musculus GN=Pex14 PE=1 SV=1 4 242 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78723|PEX14_PICAN Peroxisomal membrane protein PER10 OS=Pichia angusta GN=PEX14 PE=3 SV=1 4 321 7.0E-42
sp|Q9HG09|PEX14_PICPA Peroxisomal membrane protein PEX14 OS=Komagataella pastoris GN=PEX14 PE=1 SV=1 2 268 2.0E-38
sp|P53112|PEX14_YEAST Peroxisomal membrane protein PEX14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX14 PE=1 SV=1 4 323 2.0E-32
sp|O60065|PEX14_SCHPO Peroxisomal membrane protein pex14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex14 PE=3 SV=1 3 322 3.0E-28
sp|Q9R0A0|PEX14_MOUSE Peroxisomal membrane protein PEX14 OS=Mus musculus GN=Pex14 PE=1 SV=1 4 242 5.0E-17
sp|Q642G4|PEX14_RAT Peroxisomal membrane protein PEX14 OS=Rattus norvegicus GN=Pex14 PE=1 SV=1 4 242 2.0E-16
sp|Q9Z2Z3|PEX14_CRILO Peroxisomal membrane protein PEX14 OS=Cricetulus longicaudatus GN=PEX14 PE=2 SV=1 4 242 1.0E-14
sp|O75381|PEX14_HUMAN Peroxisomal membrane protein PEX14 OS=Homo sapiens GN=PEX14 PE=1 SV=1 4 242 1.0E-13
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2921
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4264
Ophiocordyceps australis map64 (Brazil) OphauB2|924
Ophiocordyceps camponoti-floridani Ophcf2|01401
Ophiocordyceps camponoti-rufipedis Ophun1|1055 (this protein)
Ophiocordyceps kimflemingae Ophio5|2189
Ophiocordyceps subramaniannii Hirsu2|490

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1055
MAIREELVASAAQFLQDPSVASSSIENKISFLRAKNLTQEEIDSSLARAGGPTTSPAQPPPAAPYPPAPLQPYHQ
PYPSYAWQQAPPPRAPTRDWRDWFIMATVVSGVGYGLYTLGKRYVTPLVAPPTPERLEQDKKAIEEQFDRAFALV
EQLAQDTEELKRAEQERTKRLDSALSDLERTMADLKTANRRREDDAQRIRDDVQALKDAIPKAMSSQKDVTDGRL
SEINGELGSLKALVTQRMSPAAGSHQPQRAATGGGSDVGEPSSSGEVQGAAAGGKSAAQNGGGGRRAGINNAVKA
SIPAWQLAAAATSTSSNGDVSNSAEAD*
Coding >Ophun1|1055
ATGGCCATCCGCGAGGAGCTCGTGGCCTCCGCGGCGCAATTCTTGCAGGACCCCAGCGTCGCCTCGTCTTCTATA
GAGAACAAGATCTCGTTTCTTCGAGCCAAGAACCTCACGCAGGAGGAGATTGACAGCTCCCTCGCGCGAGCCGGC
GGCCCGACAACTTCTCCCGCCCAGCCGCCTCCCGCTGCGCCGTATCCTCCCGCGCCTCTACAGCCCTACCATCAG
CCCTACCCTTCCTATGCGTGGCAGCAGGCTCCTCCGCCTCGGGCCCCGACCAGGGACTGGCGGGACTGGTTCATA
ATGGCGACGGTCGTCAGCGGCGTGGGATATGGCTTGTATACGCTCGGCAAGCGCTACGTAACACCGCTCGTAGCG
CCGCCGACGCCGGAGAGACTCGAGCAGGACAAAAAGGCCATCGAGGAACAGTTCGACAGGGCCTTTGCCCTGGTA
GAGCAGCTGGCCCAGGACACGGAGGAGCTCAAAAGGGCCGAACAGGAGAGGACAAAGAGGCTAGACTCGGCTTTG
TCGGATCTCGAGCGGACCATGGCGGACCTCAAGACGGCGAATCGGCGGAGAGAGGACGACGCGCAGCGCATCCGC
GACGATGTACAGGCCCTCAAGGACGCCATCCCCAAGGCCATGAGCAGTCAAAAAGACGTCACAGATGGTCGTCTG
TCGGAAATCAATGGGGAACTGGGCAGTCTCAAGGCGCTGGTGACGCAAAGAATGTCTCCGGCCGCGGGCAGTCAC
CAACCGCAGCGGGCAGCGACGGGCGGTGGCAGTGATGTTGGTGAGCCTTCGAGCTCAGGCGAGGTGCAGGGAGCG
GCGGCAGGGGGGAAGAGCGCAGCGCAAAATGGTGGCGGCGGCAGACGTGCAGGCATCAACAACGCGGTCAAGGCG
TCGATCCCGGCGTGGCAGCTGGCGGCGGCAGCAACGTCGACGAGCAGCAACGGGGACGTCAGCAACAGCGCCGAG
GCAGACTAA
Transcript >Ophun1|1055
ATGGCCATCCGCGAGGAGCTCGTGGCCTCCGCGGCGCAATTCTTGCAGGACCCCAGCGTCGCCTCGTCTTCTATA
GAGAACAAGATCTCGTTTCTTCGAGCCAAGAACCTCACGCAGGAGGAGATTGACAGCTCCCTCGCGCGAGCCGGC
GGCCCGACAACTTCTCCCGCCCAGCCGCCTCCCGCTGCGCCGTATCCTCCCGCGCCTCTACAGCCCTACCATCAG
CCCTACCCTTCCTATGCGTGGCAGCAGGCTCCTCCGCCTCGGGCCCCGACCAGGGACTGGCGGGACTGGTTCATA
ATGGCGACGGTCGTCAGCGGCGTGGGATATGGCTTGTATACGCTCGGCAAGCGCTACGTAACACCGCTCGTAGCG
CCGCCGACGCCGGAGAGACTCGAGCAGGACAAAAAGGCCATCGAGGAACAGTTCGACAGGGCCTTTGCCCTGGTA
GAGCAGCTGGCCCAGGACACGGAGGAGCTCAAAAGGGCCGAACAGGAGAGGACAAAGAGGCTAGACTCGGCTTTG
TCGGATCTCGAGCGGACCATGGCGGACCTCAAGACGGCGAATCGGCGGAGAGAGGACGACGCGCAGCGCATCCGC
GACGATGTACAGGCCCTCAAGGACGCCATCCCCAAGGCCATGAGCAGTCAAAAAGACGTCACAGATGGTCGTCTG
TCGGAAATCAATGGGGAACTGGGCAGTCTCAAGGCGCTGGTGACGCAAAGAATGTCTCCGGCCGCGGGCAGTCAC
CAACCGCAGCGGGCAGCGACGGGCGGTGGCAGTGATGTTGGTGAGCCTTCGAGCTCAGGCGAGGTGCAGGGAGCG
GCGGCAGGGGGGAAGAGCGCAGCGCAAAATGGTGGCGGCGGCAGACGTGCAGGCATCAACAACGCGGTCAAGGCG
TCGATCCCGGCGTGGCAGCTGGCGGCGGCAGCAACGTCGACGAGCAGCAACGGGGACGTCAGCAACAGCGCCGAG
GCAGACTAA
Gene >Ophun1|1055
ATGGCCATCCGCGAGGAGCTCGTGGCCTCCGCGGTGAGTAAAACATCTCTCAGCTTCGCCAGCTTCGACGCTGAC
GGTCTCGTCCTTTGGTCTCGTCCTTTTCCTCTCTAGGCGCAATGTCAGTTACCACCGTACACGCGAGCAAGCCGC
GACGCAGCTGACGCCACCATCAAGTCTTGCAGGACCCCAGCGTCGCCTCGTCTTCTATAGAGAACAAGATCTCGT
TTCTTCGAGCCAAGAACCTCACGCAGGAGGAGATTGACAGCTCCCTCGCGCGAGCCGGCGGCCCGACAACTTCTC
CCGCCCAGCCGCCTCCCGCTGCGCCGTATCCTCCCGCGCCTCTACAGCCCTACCATCAGCCCTACCCTTCCTATG
CGTGGCAGCAGGCTCCTCCGCCTCGGGCCCCGACCAGGGACTGGCGGGACTGGTTCATAATGGCGACGGTCGTCA
GCGGCGTGGGATATGGCTTGTATACGCTCGGCAAGGTATCGCGGGCCACTCATCTACACGGAGACTACCGAAATG
CTGATGCTAAAACTACCAGCGCTACGTAACACCGCTCGTAGCGCCGCCGACGCCGGAGAGACTCGAGCAGGACAA
AAAGGCCATCGAGGAACAGTTCGACAGGGCCTTTGCCCTGGTAGAGCAGCTGGCCCAGGACACGGAGGAGCTCAA
AAGGGCCGAACAGGAGAGGACAAAGAGGCTAGACTCGGCTTTGTCGGATCTCGAGCGGACCATGGCGGACCTCAA
GACGGCGAATCGGCGGAGAGAGGACGACGCGCAGCGCATCCGCGACGATGTACAGGCCCTCAAGGACGCCATCCC
CAAGGCCATGAGCAGTCAAAAAGACGTCACAGATGGTCGTCTGTCGGAAATCAATGGGGAACTGGGCAGTCTCAA
GGCGCTGGTGACGCAAAGAATGTCTCCGGCCGCGGGCAGTCACCAACCGCAGCGGGCAGCGACGGGCGGTGGCAG
TGATGTTGGTGAGCCTTCGAGCTCAGGCGAGGTGCAGGGAGCGGCGGCAGGGGGGAAGAGCGCAGCGCAAAATGG
TGGCGGCGGCAGACGTGCAGGCATCAACAACGCGGTCAAGGCGTCGATCCCGGCGTGGCAGCTGGCGGCGGCAGC
AACGTCGACGAGCAGCAACGGGGACGTCAGCAACAGCGCCGAGGCAGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail