Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1052
Gene name
LocationContig_14:23251..25060
Strand+
Gene length (bp)1809
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08740 BCS1_N BCS1 N terminal 3.7E-53 47 240
PF00004 AAA ATPase family associated with various cellular activities (AAA) 3.1E-09 278 342
PF00004 AAA ATPase family associated with various cellular activities (AAA) 7.7E-06 381 427

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54DY9|BCS1B_DICDI Probable mitochondrial chaperone BCS1-B OS=Dictyostelium discoideum GN=bcsl1b PE=3 SV=1 42 524 1.0E-65
sp|Q54HY8|BCS1A_DICDI Probable mitochondrial chaperone BCS1-A OS=Dictyostelium discoideum GN=bcs1la PE=3 SV=1 30 521 4.0E-55
sp|Q7ZV60|BCS1_DANRE Mitochondrial chaperone BCS1 OS=Danio rerio GN=bcs1l PE=2 SV=2 65 442 2.0E-54
sp|Q7ZTL7|BCS1_XENLA Mitochondrial chaperone BCS1 OS=Xenopus laevis GN=bcs1l PE=2 SV=1 65 442 1.0E-52
sp|Q5E9H5|BCS1_BOVIN Mitochondrial chaperone BCS1 OS=Bos taurus GN=BCS1L PE=2 SV=1 65 521 5.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54DY9|BCS1B_DICDI Probable mitochondrial chaperone BCS1-B OS=Dictyostelium discoideum GN=bcsl1b PE=3 SV=1 42 524 1.0E-65
sp|Q54HY8|BCS1A_DICDI Probable mitochondrial chaperone BCS1-A OS=Dictyostelium discoideum GN=bcs1la PE=3 SV=1 30 521 4.0E-55
sp|Q7ZV60|BCS1_DANRE Mitochondrial chaperone BCS1 OS=Danio rerio GN=bcs1l PE=2 SV=2 65 442 2.0E-54
sp|Q7ZTL7|BCS1_XENLA Mitochondrial chaperone BCS1 OS=Xenopus laevis GN=bcs1l PE=2 SV=1 65 442 1.0E-52
sp|Q5E9H5|BCS1_BOVIN Mitochondrial chaperone BCS1 OS=Bos taurus GN=BCS1L PE=2 SV=1 65 521 5.0E-52
sp|Q9CZP5|BCS1_MOUSE Mitochondrial chaperone BCS1 OS=Mus musculus GN=Bcs1l PE=1 SV=1 65 521 6.0E-50
sp|P32839|BCS1_YEAST Mitochondrial chaperone BCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCS1 PE=1 SV=2 65 520 6.0E-49
sp|Q9Y276|BCS1_HUMAN Mitochondrial chaperone BCS1 OS=Homo sapiens GN=BCS1L PE=1 SV=1 65 521 6.0E-49
sp|Q9P6Q3|BCS1_SCHPO Probable mitochondrial chaperone bcs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.07 PE=2 SV=1 18 498 2.0E-47
sp|Q9FN75|AATPI_ARATH AAA-ATPase At5g17760 OS=Arabidopsis thaliana GN=At5g17760 PE=2 SV=1 200 427 2.0E-29
sp|Q9FN77|AATPG_ARATH AAA-ATPase At5g17740 OS=Arabidopsis thaliana GN=At5g17740 PE=3 SV=1 173 427 2.0E-27
sp|Q9FN78|AATPF_ARATH AAA-ATPase At5g17730 OS=Arabidopsis thaliana GN=At5g17730 PE=3 SV=1 168 437 5.0E-27
sp|Q147F9|AATPC_ARATH AAA-ATPase At3g50940 OS=Arabidopsis thaliana GN=At3g50940 PE=2 SV=1 209 424 3.0E-26
sp|Q8RY66|AATPD_ARATH AAA-ATPase At4g25835 OS=Arabidopsis thaliana GN=At4g25835 PE=2 SV=1 203 542 5.0E-26
sp|Q9FKM3|AATPK_ARATH AAA-ATPase At5g57480 OS=Arabidopsis thaliana GN=At5g57480 PE=3 SV=1 203 430 1.0E-25
sp|Q8VZG2|HSR4_ARATH Protein HYPER-SENSITIVITY-RELATED 4 OS=Arabidopsis thaliana GN=HSR4 PE=2 SV=1 203 556 5.0E-25
sp|Q9LP11|AATP1_ARATH AAA-ATPase At1g43910 OS=Arabidopsis thaliana GN=At1g43910 PE=1 SV=1 179 445 8.0E-24
sp|F4KID5|AATPH_ARATH AAA-ATPase At5g17750 OS=Arabidopsis thaliana GN=At5g17750 PE=3 SV=1 200 427 1.0E-23
sp|F4KFX5|AATPJ_ARATH AAA-ATPase At5g40000 OS=Arabidopsis thaliana GN=At5g40000 PE=3 SV=1 237 424 2.0E-23
sp|Q8GW96|AATP3_ARATH AAA-ATPase At2g18193 OS=Arabidopsis thaliana GN=At2g18193 PE=2 SV=1 237 436 2.0E-23
sp|F4IQG2|AATP2_ARATH AAA-ATPase At2g18190 OS=Arabidopsis thaliana GN=At2g18190 PE=2 SV=1 237 436 2.0E-23
sp|Q9FLD5|ASD_ARATH AAA-ATPase ASD, mitochondrial OS=Arabidopsis thaliana GN=AATP1 PE=1 SV=1 164 424 5.0E-23
sp|F4JPK8|AATPE_ARATH AAA-ATPase At4g30250 OS=Arabidopsis thaliana GN=At4g30250 PE=3 SV=1 265 429 5.0E-23
sp|F4J0C0|AATPA_ARATH AAA-ATPase At3g28600 OS=Arabidopsis thaliana GN=At3g28600 PE=2 SV=1 237 424 5.0E-22
sp|F4J0B7|AATP8_ARATH AAA-ATPase At3g28570, mitochondrial OS=Arabidopsis thaliana GN=At3g28570 PE=3 SV=1 195 426 3.0E-21
sp|Q9LJJ5|AATPB_ARATH AAA-ATPase At3g28610 OS=Arabidopsis thaliana GN=At3g28610 PE=2 SV=1 237 424 8.0E-21
sp|Q9LH84|AATP5_ARATH AAA-ATPase At3g28510 OS=Arabidopsis thaliana GN=At3g28510 PE=2 SV=1 155 507 1.0E-20
sp|Q9LJJ7|AATP9_ARATH AAA-ATPase At3g28580 OS=Arabidopsis thaliana GN=At3g28580 PE=2 SV=1 239 424 1.0E-19
sp|Q9LH83|AATP6_ARATH AAA-ATPase At3g28520 OS=Arabidopsis thaliana GN=At3g28520 PE=3 SV=1 244 424 3.0E-19
sp|Q9LH82|AATP7_ARATH AAA-ATPase At3g28540 OS=Arabidopsis thaliana GN=At3g28540 PE=2 SV=1 177 424 3.0E-19
sp|Q5UR45|YL572_MIMIV Putative AAA family ATPase L572 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L572 PE=3 SV=1 379 517 2.0E-15
sp|Q6M2F0|FTSH_CORGL ATP-dependent zinc metalloprotease FtsH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ftsH PE=3 SV=1 249 425 1.0E-13
sp|F4IJ77|AATP4_ARATH AAA-ATPase At2g46620 OS=Arabidopsis thaliana GN=At2g46620 PE=2 SV=1 206 520 2.0E-13
sp|A6LD25|FTSH_PARD8 ATP-dependent zinc metalloprotease FtsH OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ftsH PE=3 SV=1 266 438 4.0E-12
sp|Q6F0E5|FTSH_MESFL ATP-dependent zinc metalloprotease FtsH OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ftsH PE=3 SV=1 191 430 5.0E-11
sp|Q8SQK0|PRS8_ENCCU 26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT6 PE=1 SV=2 265 426 6.0E-11
sp|C8W731|FTSH_ATOPD ATP-dependent zinc metalloprotease FtsH OS=Atopobium parvulum (strain ATCC 33793 / DSM 20469 / JCM 10300 / VPI 0546) GN=ftsH PE=3 SV=1 266 430 7.0E-11
sp|P32795|YME1_YEAST Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YME1 PE=1 SV=1 251 430 1.0E-10
sp|O88967|YMEL1_MOUSE ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus GN=Yme1l1 PE=1 SV=1 244 425 1.0E-10
sp|Q0DHL4|FTSH8_ORYSJ ATP-dependent zinc metalloprotease FTSH 8, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH8 PE=3 SV=1 244 455 2.0E-10
sp|Q96TA2|YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2 244 425 2.0E-10
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 265 439 2.0E-10
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 265 441 2.0E-10
sp|D0MGU8|FTSH_RHOM4 ATP-dependent zinc metalloprotease FtsH OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=ftsH PE=3 SV=1 275 440 2.0E-10
sp|P46508|YME1_SCHMA ATP-dependent zinc metalloprotease YME1 homolog OS=Schistosoma mansoni PE=2 SV=1 243 424 4.0E-10
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 266 450 2.0E-09
sp|Q3B6R3|FTSH_CHLL7 ATP-dependent zinc metalloprotease FtsH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ftsH PE=3 SV=1 251 424 2.0E-09
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 266 440 2.0E-09
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 270 469 2.0E-09
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 265 441 2.0E-09
sp|Q8SRH0|PRS4_ENCCU 26S protease regulatory subunit 4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT2 PE=1 SV=1 265 438 3.0E-09
sp|A9GAW6|FTSH3_SORC5 ATP-dependent zinc metalloprotease FtsH 3 OS=Sorangium cellulosum (strain So ce56) GN=ftsH3 PE=3 SV=1 246 426 5.0E-09
sp|Q2LUQ1|FTSH_SYNAS ATP-dependent zinc metalloprotease FtsH OS=Syntrophus aciditrophicus (strain SB) GN=ftsH PE=3 SV=1 266 439 5.0E-09
sp|B1ZMG6|FTSH_OPITP ATP-dependent zinc metalloprotease FtsH OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ftsH PE=3 SV=1 217 430 5.0E-09
sp|Q67LC0|FTSH1_SYMTH ATP-dependent zinc metalloprotease FtsH 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH1 PE=3 SV=1 212 443 7.0E-09
sp|P40341|YTA12_YEAST Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA12 PE=1 SV=2 266 438 9.0E-09
sp|Q3JEE4|FTSH_NITOC ATP-dependent zinc metalloprotease FtsH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ftsH PE=3 SV=1 244 431 1.0E-08
sp|D5H7Z5|FTSH1_SALRM ATP-dependent zinc metalloprotease FtsH 1 OS=Salinibacter ruber (strain M8) GN=ftsH1 PE=3 SV=1 276 443 1.0E-08
sp|Q8VZI8|FTSHA_ARATH ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana GN=FTSH10 PE=1 SV=1 244 438 1.0E-08
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 266 430 2.0E-08
sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 266 459 2.0E-08
sp|Q9HGM3|YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yta12 PE=3 SV=1 264 440 3.0E-08
sp|D5D8E3|FTSH_SULMD ATP-dependent zinc metalloprotease FtsH OS=Sulcia muelleri (strain DMIN) GN=ftsH PE=3 SV=1 248 424 3.0E-08
sp|D1CDT8|FTSH_THET1 ATP-dependent zinc metalloprotease FtsH OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) GN=ftsH PE=3 SV=1 244 421 3.0E-08
sp|B2UE66|FTSH_RALPJ ATP-dependent zinc metalloprotease FtsH OS=Ralstonia pickettii (strain 12J) GN=ftsH PE=3 SV=1 266 454 4.0E-08
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 270 471 4.0E-08
sp|C7MWW2|ARC_SACVD Proteasome-associated ATPase OS=Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / NBRC 12207 / P101) GN=arc PE=3 SV=1 275 512 5.0E-08
sp|P34732|SEC18_CANAX Vesicular-fusion protein SEC18 OS=Candida albicans GN=SEC18 PE=3 SV=2 263 438 5.0E-08
sp|Q8SR13|PRS6A_ENCCU 26S protease regulatory subunit 6A OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT5 PE=1 SV=1 275 430 6.0E-08
sp|A1TZE0|FTSH_MARHV ATP-dependent zinc metalloprotease FtsH OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ftsH PE=3 SV=1 244 440 8.0E-08
sp|A3CV35|PAN_METMJ Proteasome-activating nucleotidase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pan PE=3 SV=1 260 447 1.0E-07
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 270 430 1.0E-07
sp|P73437|FTSH4_SYNY3 ATP-dependent zinc metalloprotease FtsH 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH4 PE=2 SV=1 251 431 1.0E-07
sp|F4KF14|FTSI4_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 4, chloroplastic OS=Arabidopsis thaliana GN=FTSHI4 PE=1 SV=1 266 475 1.0E-07
sp|B4U7U4|FTSH_HYDS0 ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1 234 424 1.0E-07
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 264 441 1.0E-07
sp|B2JVU2|FTSH_BURP8 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ftsH PE=3 SV=1 248 431 2.0E-07
sp|Q9MUP8|YCF2_MESVI Protein Ycf2 OS=Mesostigma viride GN=ycf2 PE=3 SV=1 273 456 3.0E-07
sp|Q54CS8|PEX6_DICDI Peroxisomal biogenesis factor 6 OS=Dictyostelium discoideum GN=pex6 PE=3 SV=1 270 429 3.0E-07
sp|O67077|FTSH_AQUAE ATP-dependent zinc metalloprotease FtsH OS=Aquifex aeolicus (strain VF5) GN=ftsH PE=1 SV=1 275 424 3.0E-07
sp|Q2FQ56|PAN_METHJ Proteasome-activating nucleotidase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pan PE=3 SV=1 260 440 3.0E-07
sp|Q9C1E9|PEX6_COLOR Peroxisomal biogenesis factor 6 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PEX6 PE=3 SV=2 260 441 4.0E-07
sp|A8ZNZ4|FTSH_ACAM1 ATP-dependent zinc metalloprotease FtsH OS=Acaryochloris marina (strain MBIC 11017) GN=ftsH PE=3 SV=1 244 424 4.0E-07
sp|C7PVU9|ARC_CATAD Proteasome-associated ATPase OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=arc PE=3 SV=1 249 438 5.0E-07
sp|A4X741|ARC_SALTO Proteasome-associated ATPase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=arc PE=3 SV=1 275 444 5.0E-07
sp|Q60AK1|FTSH_METCA ATP-dependent zinc metalloprotease FtsH OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ftsH PE=3 SV=1 243 431 6.0E-07
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 266 440 6.0E-07
sp|D4GUJ7|PAN1_HALVD Proteasome-activating nucleotidase 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan1 PE=1 SV=2 140 439 6.0E-07
sp|A8M2A0|ARC_SALAI Proteasome-associated ATPase OS=Salinispora arenicola (strain CNS-205) GN=arc PE=3 SV=1 275 438 8.0E-07
sp|A1SK07|ARC_NOCSJ Proteasome-associated ATPase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=arc PE=3 SV=1 275 438 1.0E-06
sp|O32617|FTSH_HELFC ATP-dependent zinc metalloprotease FtsH OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ftsH PE=3 SV=1 243 421 2.0E-06
sp|A6UQT3|PAN_METVS Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1 265 439 2.0E-06
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 270 430 2.0E-06
sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 266 441 3.0E-06
sp|A6VHR1|PAN_METM7 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1 265 432 3.0E-06
sp|A9A916|PAN_METM6 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1 265 432 3.0E-06
sp|Q6LWR0|PAN_METMP Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain S2 / LL) GN=pan PE=3 SV=1 265 432 3.0E-06
sp|A4G0S4|PAN_METM5 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1 265 432 3.0E-06
sp|Q5UT56|PAN2_HALVD Proteasome-activating nucleotidase 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan2 PE=2 SV=1 265 424 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 37 54 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1052
MDTPSAPQFAILDYLLPGFSSIISAANAFLGIDIGRYLPAIVVVLGGIVAWGHVRDSLWALVEDHLMSSVRIRTD
DEIYNYVMLWLSKQRFATSSRHFLANTDINSRSSYMYRYGDSDDERDSDDDDDDDDKARDARGGSKALRYTPAFG
AHWFWYGRQPLVFERHQNRERMSFETASEREELSLSCFGRSPRLLKELLLEARAMHLRRDKRKTLIYRGNLLSVS
WQRCMARLNRPMQTVILSERVKQDMIDDAADYLDPATRRWYANRGIPYRRGYLLYGPPGTGKSSLSLALAGYFGI
KIYMVSLSSASATEENITTLFNDLPTRCIVLLEDIDTAGLAHTRDDAQPSSDPAPGPPPAPMQTGGRPAASPPST
AGGRLSLSGLLNILDGVASQEGRILIMTTNHVDKLDKALIRPGRVDMTIPFGLADRDMMSSIFRAIYAPYDNETS
LLGRRRCSTDTHDIEEAKLRYEHNQRERERVGKMAEQFANKMPELEFSPAEIQGLLLRHKRSPEVAMAAVEDWVV
RMRRDKRERAEKEAAAQQMEGKQQGAEKTQAGDEARDDGPKVQMQTIEARSDEETSTTGTSPLTGAKNASDSGYE
TP*
Coding >Ophun1|1052
ATGGACACGCCCAGCGCACCGCAGTTTGCCATCCTCGACTACCTCCTGCCGGGCTTCTCAAGCATCATCTCGGCA
GCCAATGCCTTTCTCGGCATCGACATCGGCCGCTACCTGCCTGCCATCGTAGTGGTTCTGGGCGGCATCGTCGCC
TGGGGTCATGTACGGGACTCGCTGTGGGCTCTGGTCGAGGACCATCTGATGTCTTCGGTACGGATCCGGACCGAC
GATGAGATTTACAACTACGTGATGCTGTGGCTGTCGAAGCAGCGGTTCGCCACGTCCTCGCGTCACTTCCTCGCC
AACACGGACATCAACTCGCGCAGCAGCTACATGTACCGATACGGAGACTCGGACGACGAGCGAGACTCGGACGAC
GATGACGACGATGACGACAAAGCCAGGGATGCCCGCGGTGGCAGCAAGGCGCTCCGCTACACGCCGGCCTTTGGC
GCCCACTGGTTCTGGTACGGCCGTCAGCCTCTCGTCTTCGAGCGTCACCAGAATAGGGAGCGCATGAGCTTCGAG
ACAGCCAGCGAGCGAGAGGAGCTCTCGTTGTCGTGCTTCGGCCGCAGTCCGCGCCTGCTCAAGGAGCTGCTGCTC
GAGGCTCGCGCCATGCACCTGCGAAGGGACAAGCGAAAGACGCTCATCTACCGCGGCAACCTCCTCAGCGTGTCG
TGGCAACGCTGCATGGCCCGTCTAAACAGGCCGATGCAGACCGTTATTCTCAGTGAGCGCGTCAAGCAGGACATG
ATTGACGACGCGGCCGACTATCTCGATCCGGCCACTCGCCGCTGGTACGCCAACCGGGGCATTCCCTACCGTCGC
GGTTATCTGCTGTATGGGCCGCCGGGCACGGGCAAGAGCTCGCTGAGCCTGGCCTTGGCGGGATACTTTGGCATC
AAGATCTACATGGTCAGCCTGAGCTCGGCTTCGGCCACCGAGGAGAACATCACGACGCTGTTCAACGACCTGCCC
ACCCGCTGCATTGTGTTGCTCGAGGATATTGATACGGCCGGCCTCGCCCATACCCGCGATGACGCTCAGCCGTCT
TCAGACCCGGCCCCGGGCCCACCTCCGGCTCCGATGCAGACCGGCGGCCGACCGGCGGCGTCGCCTCCTTCTACG
GCCGGCGGGCGTCTCTCTTTATCGGGTCTGCTCAACATTCTCGACGGCGTCGCCTCGCAGGAGGGACGTATACTC
ATCATGACGACCAACCACGTCGACAAGCTGGACAAGGCTCTCATCCGTCCCGGCCGTGTCGACATGACGATTCCC
TTTGGCCTGGCCGATAGGGACATGATGTCTTCCATCTTCCGCGCCATATATGCCCCGTACGACAACGAGACGTCG
CTCCTTGGCCGACGACGTTGCTCTACCGACACCCATGACATCGAAGAGGCGAAGCTGCGGTACGAGCACAACCAG
AGAGAGCGCGAGCGCGTAGGAAAAATGGCCGAGCAGTTCGCCAACAAGATGCCCGAGCTGGAGTTTAGCCCAGCC
GAGATTCAGGGTCTCCTGCTGCGGCACAAGCGGAGTCCAGAGGTAGCCATGGCCGCTGTGGAAGACTGGGTTGTC
CGCATGCGCAGGGACAAGAGGGAGCGTGCCGAGAAAGAGGCGGCAGCCCAGCAGATGGAGGGCAAGCAGCAAGGG
GCCGAGAAGACACAGGCTGGTGACGAAGCGAGAGACGATGGGCCAAAGGTCCAGATGCAGACGATAGAAGCCAGG
AGCGACGAGGAAACGTCGACGACAGGCACGAGCCCGTTGACGGGGGCCAAGAACGCGTCCGACTCGGGCTACGAG
ACGCCCTGA
Transcript >Ophun1|1052
ATGGACACGCCCAGCGCACCGCAGTTTGCCATCCTCGACTACCTCCTGCCGGGCTTCTCAAGCATCATCTCGGCA
GCCAATGCCTTTCTCGGCATCGACATCGGCCGCTACCTGCCTGCCATCGTAGTGGTTCTGGGCGGCATCGTCGCC
TGGGGTCATGTACGGGACTCGCTGTGGGCTCTGGTCGAGGACCATCTGATGTCTTCGGTACGGATCCGGACCGAC
GATGAGATTTACAACTACGTGATGCTGTGGCTGTCGAAGCAGCGGTTCGCCACGTCCTCGCGTCACTTCCTCGCC
AACACGGACATCAACTCGCGCAGCAGCTACATGTACCGATACGGAGACTCGGACGACGAGCGAGACTCGGACGAC
GATGACGACGATGACGACAAAGCCAGGGATGCCCGCGGTGGCAGCAAGGCGCTCCGCTACACGCCGGCCTTTGGC
GCCCACTGGTTCTGGTACGGCCGTCAGCCTCTCGTCTTCGAGCGTCACCAGAATAGGGAGCGCATGAGCTTCGAG
ACAGCCAGCGAGCGAGAGGAGCTCTCGTTGTCGTGCTTCGGCCGCAGTCCGCGCCTGCTCAAGGAGCTGCTGCTC
GAGGCTCGCGCCATGCACCTGCGAAGGGACAAGCGAAAGACGCTCATCTACCGCGGCAACCTCCTCAGCGTGTCG
TGGCAACGCTGCATGGCCCGTCTAAACAGGCCGATGCAGACCGTTATTCTCAGTGAGCGCGTCAAGCAGGACATG
ATTGACGACGCGGCCGACTATCTCGATCCGGCCACTCGCCGCTGGTACGCCAACCGGGGCATTCCCTACCGTCGC
GGTTATCTGCTGTATGGGCCGCCGGGCACGGGCAAGAGCTCGCTGAGCCTGGCCTTGGCGGGATACTTTGGCATC
AAGATCTACATGGTCAGCCTGAGCTCGGCTTCGGCCACCGAGGAGAACATCACGACGCTGTTCAACGACCTGCCC
ACCCGCTGCATTGTGTTGCTCGAGGATATTGATACGGCCGGCCTCGCCCATACCCGCGATGACGCTCAGCCGTCT
TCAGACCCGGCCCCGGGCCCACCTCCGGCTCCGATGCAGACCGGCGGCCGACCGGCGGCGTCGCCTCCTTCTACG
GCCGGCGGGCGTCTCTCTTTATCGGGTCTGCTCAACATTCTCGACGGCGTCGCCTCGCAGGAGGGACGTATACTC
ATCATGACGACCAACCACGTCGACAAGCTGGACAAGGCTCTCATCCGTCCCGGCCGTGTCGACATGACGATTCCC
TTTGGCCTGGCCGATAGGGACATGATGTCTTCCATCTTCCGCGCCATATATGCCCCGTACGACAACGAGACGTCG
CTCCTTGGCCGACGACGTTGCTCTACCGACACCCATGACATCGAAGAGGCGAAGCTGCGGTACGAGCACAACCAG
AGAGAGCGCGAGCGCGTAGGAAAAATGGCCGAGCAGTTCGCCAACAAGATGCCCGAGCTGGAGTTTAGCCCAGCC
GAGATTCAGGGTCTCCTGCTGCGGCACAAGCGGAGTCCAGAGGTAGCCATGGCCGCTGTGGAAGACTGGGTTGTC
CGCATGCGCAGGGACAAGAGGGAGCGTGCCGAGAAAGAGGCGGCAGCCCAGCAGATGGAGGGCAAGCAGCAAGGG
GCCGAGAAGACACAGGCTGGTGACGAAGCGAGAGACGATGGGCCAAAGGTCCAGATGCAGACGATAGAAGCCAGG
AGCGACGAGGAAACGTCGACGACAGGCACGAGCCCGTTGACGGGGGCCAAGAACGCGTCCGACTCGGGCTACGAG
ACGCCCTGA
Gene >Ophun1|1052
ATGGACACGCCCAGCGCACCGCAGTTTGCCATCCTCGACTACCTCCTGCCGGGCTTCTCAAGCATCATCTCGGCA
GCCAATGCCTTTCTCGGCATCGACATCGGCCGCTACCTGCCTGCCATCGTAGTGGTTCTGGGCGGCATCGTCGCC
TGGGGTCATGTACGGGACTCGCTGTGGGCTCTGGTCGAGGACCATCTGATGTCTTCGGTACGGATCCGGACCGAC
GATGAGATTTACAACTACGTGATGCTGTGGCTGTCGAAGCAGCGGTTCGCCACGTCCTCGCGTCACTTCCTCGCC
AACACGGACATCAACTCGCGCAGCAGCTACATGTACCGATACGGAGACTCGGACGACGAGCGAGACTCGGACGAC
GATGACGACGATGACGACAAAGCCAGGGATGCCCGCGGTGGCAGCAAGGCGCTCCGCTACACGCCGGCCTTTGGC
GCCCACTGGTTCTGGTACGGCCGTCAGCCTCTCGTCTTCGAGCGTCACCAGAATAGGGAGCGCATGAGCTTCGAG
ACAGCCAGCGAGCGAGAGGAGCTCTCGTTGTCGTGCTTCGGCCGCAGTCCGCGCCTGCTCAAGGAGCTGCTGCTC
GAGGCTCGCGCCATGCACCTGCGAAGGGACAAGCGAAAGACGCTCATCTACCGCGGCAACCTCCTCAGCGTGTCG
TGGCAACGCTGCATGGCCCGTCTAAACAGGCCGATGCAGACCGTTATTCTCAGTGAGCGCGTCAAGCAGGACATG
ATTGACGACGCGGCCGACTATCTCGATCCGGCCACTCGCCGCTGGTACGCCAACCGGGGCATTCCCTACCGTCGC
GGTTATCTGCTGTATGGGCCGCCGGGCACGGGCAAGAGCTCGCTGAGCCTGGCCTTGGCGGGATACTTTGGCATC
AAGATCTACATGGTCAGCCTGAGCTCGGCTTCGGCCACCGAGGAGAACATCACGACGCTGTTCAACGACCTGCCC
ACCCGCTGCATTGTGTTGCTCGAGGATATTGATACGGCCGGCCTCGCCCATACCCGCGATGACGCTCAGCCGTCT
TCAGACCCGGCCCCGGGCCCACCTCCGGCTCCGATGCAGACCGGCGGCCGACCGGCGGCGTCGCCTCCTTCTACG
GCCGGCGGGCGTCTCTCTTTATCGGGTCTGCTCAACATTCTCGACGGCGTCGCCTCGCAGGAGGGACGTATACTC
ATCATGACGACCAACCACGTCGACAAGCTGGACAAGGCTCTCATCCGTCCCGGCCGTGTCGACATGACGATTCCC
TTTGGCCTGGCCGATAGGGACATGATGTCTTCCATCTTCCGCGCCATATATGCCCCGTACGACAACGAGACGTCG
CTCCTTGGCCGACGACGTTGCTCTACCGACACCCATGACATCGAAGAGGCGAAGCTGCGGTACGAGCACAACCAG
AGAGAGCGCGAGCGCGTAGGAAAAATGGCCGAGCAGTTCGCCAACAAGATGCCCGAGCTGGAGTTTAGCCCAGCC
GAGATTCAGGGTCTCCTGCTGCGGCACAAGCGGAGTCCAGAGGTAGCCATGGCCGCTGTGGAAGACTGGGTTGTC
CGCATGCGCAGGGACAAGAGGGAGCGTGCCGAGAAAGAGGCGGCAGCCCAGCAGATGGAGGGCAAGCAGCAAGGG
GCCGAGAAGACACAGGCTGGTGACGAAGCGAGAGACGATGGGCCAAAGGTCCAGATGCAGACGATAGAAGCCAGG
AGCGACGAGGAAACGTCGACGACAGGCACGAGCCCGTTGACGGGGGCCAAGAACGCGTCCGACTCGGGCTACGAG
ACGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail