Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1048
Gene name
LocationContig_14:15300..16390
Strand-
Gene length (bp)1090
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 7.7E-06 34 72
PF00400 WD40 WD domain, G-beta repeat 5.3E-05 194 229
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 2.1E-04 79 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GSM6|SEC13_CHAGB Protein transport protein SEC13 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC13 PE=3 SV=1 1 290 3.0E-175
sp|G0SA60|SEC13_CHATD Protein transport protein SEC13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=SEC13 PE=3 SV=2 1 290 9.0E-173
sp|Q7RZF5|SEC13_NEUCR Protein transport protein sec13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nup-20 PE=3 SV=2 1 290 2.0E-172
sp|A4REK3|SEC13_MAGO7 Protein transport protein SEC13 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC13 PE=3 SV=3 1 290 3.0E-155
sp|Q2UG43|SEC13_ASPOR Protein transport protein sec13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec13 PE=3 SV=1 1 290 6.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GSM6|SEC13_CHAGB Protein transport protein SEC13 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC13 PE=3 SV=1 1 290 3.0E-175
sp|G0SA60|SEC13_CHATD Protein transport protein SEC13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=SEC13 PE=3 SV=2 1 290 9.0E-173
sp|Q7RZF5|SEC13_NEUCR Protein transport protein sec13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nup-20 PE=3 SV=2 1 290 2.0E-172
sp|A4REK3|SEC13_MAGO7 Protein transport protein SEC13 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC13 PE=3 SV=3 1 290 3.0E-155
sp|Q2UG43|SEC13_ASPOR Protein transport protein sec13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec13 PE=3 SV=1 1 290 6.0E-148
sp|Q4WNK7|SEC13_ASPFU Protein transport protein sec13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec13 PE=3 SV=1 2 290 7.0E-147
sp|A2QHM1|SEC13_ASPNC Protein transport protein sec13 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec13 PE=3 SV=1 1 290 1.0E-146
sp|A1CGS0|SEC13_ASPCL Protein transport protein sec13 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec13 PE=3 SV=1 1 290 2.0E-146
sp|Q5B563|SEC13_EMENI Protein transport protein sec13 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec13 PE=3 SV=1 1 290 2.0E-145
sp|Q0CHM0|SEC13_ASPTN Protein transport protein sec13 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec13 PE=3 SV=1 1 290 8.0E-145
sp|Q1DZQ0|SEC13_COCIM Protein transport protein SEC13 OS=Coccidioides immitis (strain RS) GN=SEC13 PE=3 SV=1 1 290 2.0E-144
sp|Q0UNA9|SEC13_PHANO Protein transport protein SEC13 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEC13 PE=3 SV=1 1 290 2.0E-140
sp|Q6BZX5|SEC13_YARLI Protein transport protein SEC13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC13 PE=3 SV=1 1 290 2.0E-113
sp|Q6BIR1|SEC13_DEBHA Protein transport protein SEC13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC13 PE=3 SV=1 1 289 2.0E-112
sp|A5DXE2|SEC13_LODEL Protein transport protein SEC13 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC13 PE=3 SV=1 1 289 6.0E-112
sp|Q6FNV4|SC131_CANGA Protein transport protein SEC13-1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC131 PE=3 SV=1 1 290 4.0E-110
sp|P53024|SEC13_PICPG Protein transport protein SEC13 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SEC13 PE=1 SV=3 1 290 5.0E-110
sp|Q5AEF2|SEC13_CANAL Protein transport protein SEC13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC13 PE=1 SV=2 1 290 4.0E-109
sp|A3LNW3|SEC13_PICST Protein transport protein SEC13 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC13 PE=3 SV=2 1 283 8.0E-109
sp|Q04491|SEC13_YEAST Protein transport protein SEC13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC13 PE=1 SV=1 1 283 3.0E-108
sp|A5DHD9|SEC13_PICGU Protein transport protein SEC13 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC13 PE=3 SV=2 1 290 7.0E-108
sp|Q6CSZ5|SEC13_KLULA Protein transport protein SEC13 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC13 PE=3 SV=1 1 290 1.0E-102
sp|Q75BS2|SEC13_ASHGO Protein transport protein SEC13 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC13 PE=3 SV=1 1 290 1.0E-100
sp|O94319|SEC13_SCHPO Protein transport protein sec13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec13 PE=1 SV=1 1 288 3.0E-99
sp|P0CS50|SEC13_CRYNJ Protein transport protein SEC13 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SEC13 PE=3 SV=1 1 285 2.0E-95
sp|P0CS51|SEC13_CRYNB Protein transport protein SEC13 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEC13 PE=3 SV=1 1 285 2.0E-95
sp|Q4PCB8|SEC13_USTMA Protein transport protein SEC13 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEC13 PE=3 SV=1 1 289 3.0E-94
sp|Q5XFW8|SEC13_RAT Protein SEC13 homolog OS=Rattus norvegicus GN=Sec13 PE=1 SV=1 1 290 6.0E-88
sp|Q9D1M0|SEC13_MOUSE Protein SEC13 homolog OS=Mus musculus GN=Sec13 PE=1 SV=3 1 290 7.0E-88
sp|P55735|SEC13_HUMAN Protein SEC13 homolog OS=Homo sapiens GN=SEC13 PE=1 SV=3 1 290 7.0E-88
sp|Q3ZCC9|SEC13_BOVIN Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 SV=1 1 290 8.0E-88
sp|O64740|SC13B_ARATH Protein transport protein SEC13 homolog B OS=Arabidopsis thaliana GN=SEC13B PE=1 SV=1 1 289 2.0E-85
sp|Q54DS8|SEC13_DICDI Protein transport protein SEC13 OS=Dictyostelium discoideum GN=sec13 PE=3 SV=1 1 289 1.0E-84
sp|Q9SRI1|SC13A_ARATH Protein transport protein SEC13 homolog A OS=Arabidopsis thaliana GN=SEC13A PE=1 SV=1 1 289 5.0E-84
sp|Q6FQU6|SC132_CANGA Protein transport protein SEC13-2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC132 PE=3 SV=1 1 285 7.0E-81
sp|Q9N4A7|SEC13_CAEEL Protein SEC13 homolog OS=Caenorhabditis elegans GN=npp-20 PE=3 SV=1 1 282 4.0E-65
sp|A8XJ40|SEC13_CAEBR Protein SEC13 homolog OS=Caenorhabditis briggsae GN=npp-20 PE=3 SV=2 1 282 2.0E-61
sp|Q4FZW5|SEH1A_XENLA Nucleoporin seh1-A OS=Xenopus laevis GN=seh1l-a PE=2 SV=1 1 289 2.0E-35
sp|Q6TGU2|SEH1_DANRE Nucleoporin seh1 OS=Danio rerio GN=seh1l PE=2 SV=2 1 289 2.0E-35
sp|Q5U4Y8|SEH1_XENTR Nucleoporin seh1 OS=Xenopus tropicalis GN=seh1l PE=2 SV=1 1 289 3.0E-35
sp|Q6GNF1|SEH1B_XENLA Nucleoporin seh1-B OS=Xenopus laevis GN=seh1l-b PE=2 SV=1 1 289 3.0E-35
sp|Q8R2U0|SEH1_MOUSE Nucleoporin SEH1 OS=Mus musculus GN=Seh1l PE=2 SV=1 1 289 1.0E-34
sp|A7YY75|SEH1_BOVIN Nucleoporin SEH1 OS=Bos taurus GN=SEH1L PE=2 SV=1 1 289 7.0E-34
sp|Q5RAN6|SEH1_PONAB Nucleoporin SEH1 OS=Pongo abelii GN=SEH1L PE=2 SV=1 1 289 1.0E-33
sp|Q96EE3|SEH1_HUMAN Nucleoporin SEH1 OS=Homo sapiens GN=SEH1L PE=1 SV=3 1 289 1.0E-33
sp|C1BK83|SEH1_OSMMO Nucleoporin seh1 OS=Osmerus mordax GN=seh1l PE=2 SV=1 1 289 2.0E-32
sp|P53011|SEH1_YEAST Nucleoporin SEH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEH1 PE=1 SV=1 1 288 1.0E-29
sp|Q10099|SEH1_SCHPO Nucleoporin seh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=seh1 PE=1 SV=1 1 288 2.0E-25
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 33 288 3.0E-20
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 34 288 2.0E-18
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 10 277 4.0E-17
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 34 288 5.0E-17
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 34 288 2.0E-16
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 34 288 4.0E-16
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 13 229 4.0E-16
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 10 277 5.0E-16
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 34 288 7.0E-16
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 34 288 7.0E-16
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 34 288 7.0E-16
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 34 288 8.0E-16
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 34 288 8.0E-16
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 34 288 9.0E-16
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 34 288 2.0E-15
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 34 288 2.0E-15
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 34 288 3.0E-15
sp|A8WVD2|SEH1_CAEBR Nucleoporin SEH1 OS=Caenorhabditis briggsae GN=npp-18 PE=3 SV=1 1 282 3.0E-15
sp|O45933|SEH1_CAEEL Nucleoporin SEH1 OS=Caenorhabditis elegans GN=npp-18 PE=3 SV=1 1 282 4.0E-15
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 1 229 5.0E-15
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 1 229 5.0E-15
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 10 277 6.0E-15
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 10 277 7.0E-15
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 1 229 8.0E-15
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 6 229 1.0E-14
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 33 276 1.0E-14
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 1 229 2.0E-14
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 10 277 3.0E-14
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 1 275 4.0E-14
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 6 229 5.0E-14
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 1 229 5.0E-14
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 10 277 5.0E-14
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 10 277 5.0E-14
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 10 277 7.0E-14
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 13 229 7.0E-14
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 13 229 7.0E-14
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 10 275 1.0E-13
sp|P0CS36|HAT2_CRYNJ Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT2 PE=3 SV=1 13 229 1.0E-13
sp|P0CS37|HAT2_CRYNB Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT2 PE=3 SV=1 13 229 1.0E-13
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 1 229 1.0E-13
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 1 229 1.0E-13
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 38 285 1.0E-13
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 1 229 1.0E-13
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 1 229 1.0E-13
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 1 229 1.0E-13
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 1 229 1.0E-13
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 1 229 1.0E-13
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 1 229 1.0E-13
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 30 288 2.0E-13
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 13 229 2.0E-13
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 1 229 2.0E-13
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 1 229 2.0E-13
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 13 229 2.0E-13
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 33 281 2.0E-13
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 1 229 2.0E-13
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 29 274 2.0E-13
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 1 229 4.0E-13
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 13 229 4.0E-13
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 13 229 4.0E-13
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 30 274 5.0E-13
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 1 229 6.0E-13
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 10 274 7.0E-13
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 1 289 7.0E-13
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 10 274 9.0E-13
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 1 229 9.0E-13
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 13 275 1.0E-12
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 45 288 1.0E-12
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 38 288 1.0E-12
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 13 289 1.0E-12
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 13 288 1.0E-12
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 13 229 1.0E-12
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 13 288 1.0E-12
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 13 229 1.0E-12
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 10 289 2.0E-12
sp|O74184|WAT1_SCHPO WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 11 275 2.0E-12
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 32 279 2.0E-12
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 32 279 2.0E-12
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 45 288 3.0E-12
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 45 288 3.0E-12
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 32 279 3.0E-12
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 1 229 3.0E-12
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 10 274 4.0E-12
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 10 238 4.0E-12
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 32 279 4.0E-12
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 13 229 4.0E-12
sp|Q6FJ73|CIAO1_CANGA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 13 287 5.0E-12
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 7 280 6.0E-12
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 10 277 8.0E-12
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 34 288 8.0E-12
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 10 235 9.0E-12
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 10 274 1.0E-11
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 13 229 1.0E-11
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 13 229 1.0E-11
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 13 229 1.0E-11
sp|Q6CMA2|CIAO1_KLULA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 13 275 1.0E-11
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 45 288 2.0E-11
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 37 247 2.0E-11
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 33 288 2.0E-11
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 1 229 2.0E-11
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 10 234 2.0E-11
sp|P0CS36|HAT2_CRYNJ Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT2 PE=3 SV=1 38 284 3.0E-11
sp|P0CS37|HAT2_CRYNB Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT2 PE=3 SV=1 38 284 3.0E-11
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 37 247 3.0E-11
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 13 289 3.0E-11
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 1 229 3.0E-11
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 10 274 4.0E-11
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 13 276 4.0E-11
sp|Q28DW0|CIAO1_XENTR Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 10 277 4.0E-11
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 1 229 5.0E-11
sp|O80990|CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 35 278 7.0E-11
sp|Q6BUA6|LIS1_DEBHA Nuclear distribution protein PAC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAC1 PE=3 SV=2 13 289 7.0E-11
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 13 229 8.0E-11
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 38 229 1.0E-10
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 38 229 1.0E-10
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 13 290 1.0E-10
sp|Q93VR9|SEH1_ARATH Protein SEH1 OS=Arabidopsis thaliana GN=SEH1 PE=1 SV=1 10 289 1.0E-10
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 34 274 1.0E-10
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 13 229 1.0E-10
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 38 229 2.0E-10
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 38 247 2.0E-10
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 13 238 2.0E-10
sp|A6ZYM0|CIAO1_YEAS7 Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 6 283 2.0E-10
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 1 229 2.0E-10
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 10 276 3.0E-10
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 34 274 3.0E-10
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 1 275 3.0E-10
sp|Q05583|CIAO1_YEAST Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 6 283 3.0E-10
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 13 289 3.0E-10
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 38 256 4.0E-10
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 10 274 4.0E-10
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 1 285 4.0E-10
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 1 229 4.0E-10
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 10 275 5.0E-10
sp|P41318|LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 11 279 5.0E-10
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 10 275 5.0E-10
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 13 276 5.0E-10
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 1 289 6.0E-10
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 1 229 6.0E-10
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 12 281 6.0E-10
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 1 275 6.0E-10
sp|F4I1S7|ELP2_ARATH Elongator complex protein 2 OS=Arabidopsis thaliana GN=ELP2 PE=1 SV=1 30 229 7.0E-10
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 10 280 8.0E-10
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 38 229 8.0E-10
sp|Q4WTL0|CIAO1_ASPFU Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cia1 PE=3 SV=1 13 261 8.0E-10
sp|B0XQ15|CIAO1_ASPFC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cia1 PE=3 SV=1 13 261 8.0E-10
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 10 276 9.0E-10
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 10 275 9.0E-10
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 10 275 9.0E-10
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 1 229 9.0E-10
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 13 229 9.0E-10
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 10 275 1.0E-09
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 37 229 1.0E-09
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 35 290 1.0E-09
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 38 256 1.0E-09
sp|Q75C26|CIAO1_ASHGO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIA1 PE=3 SV=1 13 289 1.0E-09
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 1 229 1.0E-09
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 1 229 1.0E-09
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 1 229 1.0E-09
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 10 274 2.0E-09
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 10 229 2.0E-09
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 38 229 2.0E-09
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 6 229 2.0E-09
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 13 238 2.0E-09
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 13 238 2.0E-09
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 13 289 2.0E-09
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 13 289 2.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 11 274 2.0E-09
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 10 238 3.0E-09
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 10 238 3.0E-09
sp|Q6FJ73|CIAO1_CANGA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 33 288 3.0E-09
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 30 274 3.0E-09
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 10 275 3.0E-09
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 1 229 3.0E-09
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 10 275 4.0E-09
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 13 288 4.0E-09
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 37 229 4.0E-09
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 10 275 4.0E-09
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 10 281 5.0E-09
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 1 229 5.0E-09
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 1 229 5.0E-09
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 1 229 5.0E-09
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 1 229 5.0E-09
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 1 229 5.0E-09
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 1 229 5.0E-09
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 13 229 5.0E-09
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 13 229 5.0E-09
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 6 229 5.0E-09
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 34 281 5.0E-09
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 25 233 6.0E-09
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 13 229 6.0E-09
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 12 182 7.0E-09
sp|Q6IA86|ELP2_HUMAN Elongator complex protein 2 OS=Homo sapiens GN=ELP2 PE=1 SV=2 12 277 7.0E-09
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 1 230 7.0E-09
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 10 275 7.0E-09
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 13 288 8.0E-09
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 10 152 9.0E-09
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 10 275 9.0E-09
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 10 275 1.0E-08
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 5 122 1.0E-08
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 37 228 1.0E-08
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 10 187 1.0E-08
sp|A6ZYM0|CIAO1_YEAS7 Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 34 284 1.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 10 290 1.0E-08
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 108 290 1.0E-08
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 108 290 1.0E-08
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 3 229 1.0E-08
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 3 229 1.0E-08
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 1 229 1.0E-08
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 34 274 1.0E-08
sp|Q0USG2|CIAO1_PHANO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CIA1 PE=3 SV=1 99 277 1.0E-08
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 6 121 2.0E-08
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 38 229 2.0E-08
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 38 229 2.0E-08
sp|Q05583|CIAO1_YEAST Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 34 284 2.0E-08
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 13 288 2.0E-08
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 10 277 2.0E-08
sp|P61480|WDR12_RAT Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1 13 271 2.0E-08
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 10 274 2.0E-08
sp|B9WHJ2|CIAO1_CANDC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CIA1 PE=3 SV=1 101 285 2.0E-08
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 14 229 2.0E-08
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 34 274 2.0E-08
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 32 276 3.0E-08
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 37 278 3.0E-08
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 13 238 3.0E-08
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 13 186 4.0E-08
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 10 229 4.0E-08
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 13 238 4.0E-08
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 13 238 4.0E-08
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 13 231 4.0E-08
sp|Q5AG86|CIAO1_CANAL Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CIA1 PE=3 SV=1 101 285 4.0E-08
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 13 229 4.0E-08
sp|C5MJE8|LIS1_CANTT Nuclear distribution protein PAC1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PAC1 PE=3 SV=1 8 235 4.0E-08
sp|Q9UT57|CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 35 274 4.0E-08
sp|Q28DW0|CIAO1_XENTR Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 30 288 5.0E-08
sp|Q2UPI0|CIAO1_ASPOR Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cia1 PE=3 SV=1 99 286 5.0E-08
sp|B8MWR8|CIAO1_ASPFN Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cia1 PE=3 SV=1 99 286 5.0E-08
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 11 274 5.0E-08
sp|Q8LPL5|FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana GN=FZR3 PE=1 SV=1 4 229 6.0E-08
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 6 121 7.0E-08
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 13 156 7.0E-08
sp|Q2UPI0|CIAO1_ASPOR Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cia1 PE=3 SV=1 13 277 7.0E-08
sp|B8MWR8|CIAO1_ASPFN Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cia1 PE=3 SV=1 13 277 7.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 10 274 7.0E-08
sp|B9WD30|LIS1_CANDC Nuclear distribution protein PAC1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PAC1 PE=3 SV=1 8 229 7.0E-08
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 5 121 8.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 10 275 8.0E-08
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 1 289 8.0E-08
sp|A1D3I2|CIAO1_NEOFI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cia1 PE=3 SV=1 13 261 8.0E-08
sp|Q0VC24|WDR12_BOVIN Ribosome biogenesis protein WDR12 OS=Bos taurus GN=WDR12 PE=2 SV=1 19 271 8.0E-08
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 6 122 9.0E-08
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 10 275 9.0E-08
sp|O22468|MSI2_ARATH WD-40 repeat-containing protein MSI2 OS=Arabidopsis thaliana GN=MSI2 PE=2 SV=1 13 229 9.0E-08
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 10 238 9.0E-08
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 121 288 1.0E-07
sp|Q6FJ73|CIAO1_CANGA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 10 152 1.0E-07
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 25 233 1.0E-07
sp|Q0USG2|CIAO1_PHANO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CIA1 PE=3 SV=1 10 281 1.0E-07
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 10 205 1.0E-07
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 52 229 1.0E-07
sp|A5DJX5|LIS1_PICGU Nuclear distribution protein PAC1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAC1 PE=3 SV=2 13 237 1.0E-07
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 1 233 1.0E-07
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 13 289 1.0E-07
sp|A3LNI7|LIS1_PICST Nuclear distribution protein PAC1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAC1 PE=3 SV=2 13 229 1.0E-07
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 10 229 1.0E-07
sp|A8PWQ8|CIAO1_MALGO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CIA1 PE=3 SV=1 10 146 1.0E-07
sp|P42935|ELP2_YEAST Elongator complex protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELP2 PE=1 SV=1 11 246 1.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 121 288 2.0E-07
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 37 243 2.0E-07
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 37 243 2.0E-07
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 59 230 2.0E-07
sp|A1D3I2|CIAO1_NEOFI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cia1 PE=3 SV=1 10 278 2.0E-07
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 24 239 2.0E-07
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 13 238 2.0E-07
sp|C4YPI7|LIS1_CANAW Nuclear distribution protein PAC1 OS=Candida albicans (strain WO-1) GN=PAC1 PE=3 SV=1 8 235 2.0E-07
sp|Q5A7Q6|LIS1_CANAL Nuclear distribution protein PAC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAC1 PE=3 SV=1 8 235 2.0E-07
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 1 275 2.0E-07
sp|Q9JJA4|WDR12_MOUSE Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1 17 271 2.0E-07
sp|Q4P553|HAT2_USTMA Histone acetyltransferase type B subunit 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT2 PE=3 SV=2 38 238 2.0E-07
sp|Q5ZMC3|WSDU1_CHICK WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 13 232 2.0E-07
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 1 229 2.0E-07
sp|O94319|SEC13_SCHPO Protein transport protein sec13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec13 PE=1 SV=1 55 290 3.0E-07
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 10 276 3.0E-07
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 6 122 3.0E-07
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 11 229 3.0E-07
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 13 290 3.0E-07
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 167 288 4.0E-07
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 5 122 4.0E-07
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 13 229 4.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 13 145 4.0E-07
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 38 233 4.0E-07
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 4 230 4.0E-07
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 9 289 4.0E-07
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 10 83 4.0E-07
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 10 229 4.0E-07
sp|Q9SXY1|FAS2_ARATH Chromatin assembly factor 1 subunit FAS2 OS=Arabidopsis thaliana GN=FAS2 PE=1 SV=1 41 231 4.0E-07
sp|A1CQL6|CIAO1_ASPCL Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cia1 PE=3 SV=1 10 280 4.0E-07
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 37 243 5.0E-07
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 37 243 5.0E-07
sp|A5DJX5|LIS1_PICGU Nuclear distribution protein PAC1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAC1 PE=3 SV=2 92 231 5.0E-07
sp|Q32SG6|HIRA_MAIZE Protein HIRA OS=Zea mays PE=1 SV=1 10 209 5.0E-07
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 6 285 5.0E-07
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 10 235 6.0E-07
sp|Q5BJ90|WDR12_XENTR Ribosome biogenesis protein wdr12 OS=Xenopus tropicalis GN=wdr12 PE=2 SV=1 19 271 6.0E-07
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 13 229 6.0E-07
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 10 276 7.0E-07
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 10 179 7.0E-07
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 37 243 7.0E-07
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 10 274 7.0E-07
sp|Q8SRK1|HAT2_ENCCU Histone acetyltransferase type B subunit 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HAT2 PE=1 SV=1 12 229 7.0E-07
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 32 229 8.0E-07
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 10 274 8.0E-07
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 9 289 8.0E-07
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 121 288 9.0E-07
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 10 278 9.0E-07
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 37 243 9.0E-07
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 37 243 9.0E-07
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 37 243 9.0E-07
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 10 208 9.0E-07
sp|Q4P553|HAT2_USTMA Histone acetyltransferase type B subunit 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT2 PE=3 SV=2 37 229 9.0E-07
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 11 275 9.0E-07
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 6 124 1.0E-06
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 167 288 1.0E-06
sp|O80990|CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 10 229 1.0E-06
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 37 243 1.0E-06
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 37 243 1.0E-06
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 34 287 1.0E-06
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 89 275 1.0E-06
sp|Q05AM5|ELP2_DANRE Elongator complex protein 2 OS=Danio rerio GN=elp2 PE=2 SV=1 30 273 1.0E-06
sp|A7TLU2|CIAO1_VANPO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CIA1 PE=3 SV=1 6 285 1.0E-06
sp|A4R7U3|CIAO1_MAGO7 Probable cytosolic iron-sulfur protein assembly protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CIA1 PE=3 SV=2 1 100 1.0E-06
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 13 231 1.0E-06
sp|B4HWV6|WDR12_DROSE Ribosome biogenesis protein WDR12 homolog OS=Drosophila sechellia GN=GM11446 PE=3 SV=1 10 231 1.0E-06
sp|Q9GZL7|WDR12_HUMAN Ribosome biogenesis protein WDR12 OS=Homo sapiens GN=WDR12 PE=1 SV=2 19 271 1.0E-06
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 10 279 1.0E-06
sp|A3LVM1|CIAO1_PICST Probable cytosolic iron-sulfur protein assembly protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CIA1 PE=3 SV=2 101 285 1.0E-06
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 1 289 1.0E-06
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 9 289 1.0E-06
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 10 204 2.0E-06
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 191 288 2.0E-06
sp|Q28DW0|CIAO1_XENTR Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 6 122 2.0E-06
sp|B3RNR8|CIAO1_TRIAD Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1 10 230 2.0E-06
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 161 274 2.0E-06
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 13 288 2.0E-06
sp|Q5EBD9|ELP2_XENTR Elongator complex protein 2 OS=Xenopus tropicalis GN=elp2 PE=2 SV=1 13 229 2.0E-06
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 161 274 2.0E-06
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 10 284 2.0E-06
sp|Q5REE6|WDR12_PONAB Ribosome biogenesis protein WDR12 OS=Pongo abelii GN=WDR12 PE=2 SV=1 19 271 2.0E-06
sp|Q4I7L0|HAT2_GIBZE Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 13 118 2.0E-06
sp|Q24572|CAF1_DROME Probable histone-binding protein Caf1 OS=Drosophila melanogaster GN=Caf1 PE=1 SV=1 13 229 2.0E-06
sp|Q10G81|MSI1_ORYSJ Histone-binding protein MSI1 homolog OS=Oryza sativa subsp. japonica GN=MSI1 PE=2 SV=1 13 229 2.0E-06
sp|Q6BIR9|CIAO1_DEBHA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CIA1 PE=3 SV=1 33 283 2.0E-06
sp|Q32LP9|COR2A_BOVIN Coronin-2A OS=Bos taurus GN=CORO2A PE=2 SV=1 12 126 2.0E-06
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 6 123 3.0E-06
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 7 229 3.0E-06
sp|A6ZYM0|CIAO1_YEAS7 Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 13 274 3.0E-06
sp|Q05583|CIAO1_YEAST Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 13 274 3.0E-06
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 10 179 3.0E-06
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 10 250 3.0E-06
sp|Q4P4R3|HIR1_USTMA Protein HIR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HIR1 PE=3 SV=1 39 267 3.0E-06
sp|Q0CCS0|CIAO1_ASPTN Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cia1 PE=3 SV=1 13 278 3.0E-06
sp|P62882|GBB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 12 230 3.0E-06
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 13 229 3.0E-06
sp|Q6INH0|RBP4B_XENLA Histone-binding protein RBBP4-B OS=Xenopus laevis GN=rbbp4-b PE=1 SV=3 13 229 3.0E-06
sp|O93377|RBP4A_XENLA Histone-binding protein RBBP4-A OS=Xenopus laevis GN=rbbp4-a PE=1 SV=3 13 229 3.0E-06
sp|O22467|MSI1_ARATH Histone-binding protein MSI1 OS=Arabidopsis thaliana GN=MSI1 PE=1 SV=1 36 229 3.0E-06
sp|Q7ZTY4|RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio GN=rbbp7 PE=2 SV=1 13 229 3.0E-06
sp|Q9W7I5|RBBP4_CHICK Histone-binding protein RBBP4 OS=Gallus gallus GN=RBBP4 PE=1 SV=3 13 229 3.0E-06
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 10 275 4.0E-06
sp|Q6FJ73|CIAO1_CANGA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 13 181 4.0E-06
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 13 229 4.0E-06
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 10 284 4.0E-06
sp|Q60972|RBBP4_MOUSE Histone-binding protein RBBP4 OS=Mus musculus GN=Rbbp4 PE=1 SV=5 13 229 4.0E-06
sp|Q09028|RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapiens GN=RBBP4 PE=1 SV=3 13 229 4.0E-06
sp|Q3MHL3|RBBP4_BOVIN Histone-binding protein RBBP4 OS=Bos taurus GN=RBBP4 PE=1 SV=3 13 229 4.0E-06
sp|Q5M7K4|RBBP4_XENTR Histone-binding protein RBBP4 OS=Xenopus tropicalis GN=rbbp4 PE=2 SV=3 13 229 4.0E-06
sp|Q5RDY7|GBB5_PONAB Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 12 230 4.0E-06
sp|Q5RF92|RBBP4_PONAB Histone-binding protein RBBP4 OS=Pongo abelii GN=RBBP4 PE=2 SV=3 13 229 4.0E-06
sp|B4P116|WDR12_DROYA Ribosome biogenesis protein WDR12 homolog OS=Drosophila yakuba GN=GE13328 PE=2 SV=1 10 231 4.0E-06
sp|P62881|GBB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 12 230 4.0E-06
sp|Q80ZD0|GBB5_TAMST Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 12 230 4.0E-06
sp|Q4P5F5|CIAO1_USTMA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CIA1 PE=3 SV=1 6 136 4.0E-06
sp|Q91WG4|ELP2_MOUSE Elongator complex protein 2 OS=Mus musculus GN=Elp2 PE=1 SV=1 28 229 4.0E-06
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 13 229 4.0E-06
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 10 275 4.0E-06
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 10 275 4.0E-06
sp|Q8VZS9|FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1 20 252 4.0E-06
sp|A6ZYM0|CIAO1_YEAS7 Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 196 290 5.0E-06
sp|Q05583|CIAO1_YEAST Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 196 290 5.0E-06
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 10 278 5.0E-06
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 13 116 5.0E-06
sp|Q4P5F5|CIAO1_USTMA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CIA1 PE=3 SV=1 34 275 5.0E-06
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 21 232 5.0E-06
sp|Q60973|RBBP7_MOUSE Histone-binding protein RBBP7 OS=Mus musculus GN=Rbbp7 PE=1 SV=1 13 229 5.0E-06
sp|Q29KQ0|WDR12_DROPS Ribosome biogenesis protein WDR12 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA19813 PE=3 SV=1 10 242 5.0E-06
sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 88 230 5.0E-06
sp|Q71UF4|RBBP7_RAT Histone-binding protein RBBP7 OS=Rattus norvegicus GN=Rbbp7 PE=2 SV=1 13 229 5.0E-06
sp|Q4R304|RBBP7_MACFA Histone-binding protein RBBP7 OS=Macaca fascicularis GN=RBBP7 PE=2 SV=1 13 229 5.0E-06
sp|Q16576|RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens GN=RBBP7 PE=1 SV=1 13 229 5.0E-06
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 30 274 5.0E-06
sp|Q6P3H7|RBBP4_DANRE Histone-binding protein RBBP4 OS=Danio rerio GN=rbbp4 PE=2 SV=3 13 229 5.0E-06
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 96 289 6.0E-06
sp|Q6CMA2|CIAO1_KLULA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 33 283 6.0E-06
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 195 289 6.0E-06
sp|Q4WTL0|CIAO1_ASPFU Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cia1 PE=3 SV=1 99 286 6.0E-06
sp|B0XQ15|CIAO1_ASPFC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cia1 PE=3 SV=1 99 286 6.0E-06
sp|Q3SWX8|RBBP7_BOVIN Histone-binding protein RBBP7 OS=Bos taurus GN=RBBP7 PE=2 SV=1 13 229 6.0E-06
sp|Q8AVH1|RBBP7_XENLA Histone-binding protein RBBP7 OS=Xenopus laevis GN=rbbp7 PE=2 SV=1 13 229 6.0E-06
sp|Q2GSJ9|HIR1_CHAGB Protein HIR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HIR1 PE=3 SV=1 1 290 6.0E-06
sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 12 230 6.0E-06
sp|Q6CMA2|CIAO1_KLULA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 10 182 7.0E-06
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 6 229 7.0E-06
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 10 278 7.0E-06
sp|A8PWQ8|CIAO1_MALGO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CIA1 PE=3 SV=1 190 290 7.0E-06
sp|Q6P315|RBBP7_XENTR Histone-binding protein RBBP7 OS=Xenopus tropicalis GN=rbbp7 PE=2 SV=1 13 229 7.0E-06
sp|B4JPT9|WDR12_DROGR Ribosome biogenesis protein WDR12 homolog OS=Drosophila grimshawi GN=GH13339 PE=3 SV=1 10 231 7.0E-06
sp|O80990|CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 13 232 8.0E-06
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 56 287 8.0E-06
sp|Q9I8G9|RBBP7_CHICK Histone-binding protein RBBP7 OS=Gallus gallus GN=RBBP7 PE=1 SV=1 13 229 8.0E-06
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 96 289 9.0E-06
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 10 120 9.0E-06
sp|B4GT01|WDR12_DROPE Ribosome biogenesis protein WDR12 homolog OS=Drosophila persimilis GN=GL26386 PE=3 SV=1 10 242 9.0E-06
sp|Q86H45|ELP2_DICDI Probable elongator complex protein 2 OS=Dictyostelium discoideum GN=elp2 PE=3 SV=1 12 229 9.0E-06
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 9 275 9.0E-06
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 10 274 1.0E-05
sp|B3RNR8|CIAO1_TRIAD Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1 68 275 1.0E-05
sp|Q3E906|CD205_ARATH Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-5 PE=1 SV=2 34 229 1.0E-05
sp|Q6PNB6|GBB5_RABIT Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 12 230 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1715
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|578
Ophiocordyceps australis map64 (Brazil) OphauB2|915
Ophiocordyceps camponoti-floridani Ophcf2|01408
Ophiocordyceps camponoti-rufipedis Ophun1|1048 (this protein)
Ophiocordyceps kimflemingae Ophio5|2183
Ophiocordyceps subramaniannii Hirsu2|153

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1048
MHDAVLDYYGRKLATCSSDRTIKIFEIEGETQRLVETLKGHEGAVWCVAWAHPKYGNILASAGYDGKVFIWKEQG
PSNQWQRIYDFTLHKASVNIVAWAPHEAGCLLACASSDGNVSVLEFKDNSVDHSTFPAHGLGVNSVSWAPATSPG
SIVSSAPSTASVGNRRFVTGGSDNNVQIWAFDAASQSYKQEREPLTGHGDWVRDVAWSPTVLHKSYIASASQDKT
VRIWASDASGSGQWDCKVLSFEAAMWRVSWSLSGNVLAVSGADNKVSLWKENLRGEWECVKTIEE*
Coding >Ophun1|1048
ATGCACGATGCCGTCCTCGACTACTACGGCCGGAAGCTGGCGACGTGCTCGAGCGACCGAACCATCAAGATCTTT
GAGATTGAGGGCGAGACGCAGCGGCTAGTCGAGACGCTCAAGGGGCACGAGGGCGCCGTCTGGTGTGTCGCCTGG
GCGCATCCCAAGTACGGAAACATCCTGGCGTCGGCGGGATATGACGGAAAGGTCTTCATCTGGAAGGAGCAGGGC
CCGTCGAATCAATGGCAGCGCATCTACGACTTCACCCTCCACAAGGCGTCGGTCAACATCGTGGCGTGGGCGCCG
CACGAGGCCGGCTGCCTCCTGGCGTGCGCATCGTCGGACGGAAACGTCAGCGTGCTCGAGTTCAAGGACAACAGC
GTCGACCACTCTACGTTCCCGGCTCACGGCCTGGGCGTCAACTCGGTGTCGTGGGCGCCGGCCACGTCCCCCGGC
AGCATCGTCAGCAGCGCGCCCAGCACGGCATCCGTGGGCAACCGGCGCTTCGTGACGGGCGGGTCCGACAATAAC
GTCCAGATCTGGGCCTTTGACGCGGCCTCGCAGTCGTACAAGCAGGAGCGCGAGCCTCTTACGGGACACGGCGAC
TGGGTGCGCGACGTGGCCTGGTCGCCGACGGTGCTGCACAAGTCGTACATTGCCTCGGCGTCGCAGGACAAGACG
GTGCGCATCTGGGCGTCGGACGCGTCGGGTTCTGGACAGTGGGACTGCAAGGTGCTCAGCTTTGAGGCGGCCATG
TGGCGGGTGAGCTGGTCGCTGAGCGGCAACGTGCTGGCTGTCAGCGGAGCGGATAACAAGGTGTCGTTGTGGAAG
GAGAACCTGCGAGGCGAGTGGGAGTGTGTCAAGACGATTGAGGAATAG
Transcript >Ophun1|1048
ATGCACGATGCCGTCCTCGACTACTACGGCCGGAAGCTGGCGACGTGCTCGAGCGACCGAACCATCAAGATCTTT
GAGATTGAGGGCGAGACGCAGCGGCTAGTCGAGACGCTCAAGGGGCACGAGGGCGCCGTCTGGTGTGTCGCCTGG
GCGCATCCCAAGTACGGAAACATCCTGGCGTCGGCGGGATATGACGGAAAGGTCTTCATCTGGAAGGAGCAGGGC
CCGTCGAATCAATGGCAGCGCATCTACGACTTCACCCTCCACAAGGCGTCGGTCAACATCGTGGCGTGGGCGCCG
CACGAGGCCGGCTGCCTCCTGGCGTGCGCATCGTCGGACGGAAACGTCAGCGTGCTCGAGTTCAAGGACAACAGC
GTCGACCACTCTACGTTCCCGGCTCACGGCCTGGGCGTCAACTCGGTGTCGTGGGCGCCGGCCACGTCCCCCGGC
AGCATCGTCAGCAGCGCGCCCAGCACGGCATCCGTGGGCAACCGGCGCTTCGTGACGGGCGGGTCCGACAATAAC
GTCCAGATCTGGGCCTTTGACGCGGCCTCGCAGTCGTACAAGCAGGAGCGCGAGCCTCTTACGGGACACGGCGAC
TGGGTGCGCGACGTGGCCTGGTCGCCGACGGTGCTGCACAAGTCGTACATTGCCTCGGCGTCGCAGGACAAGACG
GTGCGCATCTGGGCGTCGGACGCGTCGGGTTCTGGACAGTGGGACTGCAAGGTGCTCAGCTTTGAGGCGGCCATG
TGGCGGGTGAGCTGGTCGCTGAGCGGCAACGTGCTGGCTGTCAGCGGAGCGGATAACAAGGTGTCGTTGTGGAAG
GAGAACCTGCGAGGCGAGTGGGAGTGTGTCAAGACGATTGAGGAATAG
Gene >Ophun1|1048
ATGGTGAGGGCTTCTCGGCTTGATGTGGACGACGGGCAGCTGATGGATAGCAGGCGGCGCAGATGATTGCCAATA
CTGGGCACGATGATATGATTGTACGGCACTCGTTTTGTTATGGACTCACTCGAGACGCGATAGGCTGACGAGACG
TCTATAGCACGATGCCGTCCTCGACTACTACGGCCGGAAGCTGGCGACGTGCTCGAGCGACCGAACCATCAAGAT
CTTTGAGATTGAGGGCGAGACGCAGCGGCTAGTCGAGACGCTCAAGGGGTAAGCAACGTCTGGATTACTCGTGGA
ACAACGATCCAGGCCCCCCTAACTGACAGCGCACAGGCACGAGGGCGCCGTCTGGTGTGTCGCCTGGGCGCATCC
CAAGTACGGAAACATCCTGGCGTCGGCGGGATATGACGGAAAGGTCTTCATCTGGAAGGAGCAGGGCCCGTCGAA
TCAATGGCAGCGCATCTACGACTTCACCCTCCACAAGGCGTCGGTCAACATCGTGGCGTGGGCGCCGCACGAGGC
CGGCTGCCTCCTGGCGTGCGCATCGTCGGACGGAAACGTCAGCGTGCTCGAGTTCAAGGACAACAGCGTCGACCA
CTCTACGTTCCCGGCTCACGGCCTGGGCGTCAACTCGGTGTCGTGGGCGCCGGCCACGTCCCCCGGCAGCATCGT
CAGCAGCGCGCCCAGCACGGCATCCGTGGGCAACCGGCGCTTCGTGACGGGCGGGTCCGACAATAACGTCCAGAT
CTGGGCCTTTGACGCGGCCTCGCAGTCGTACAAGCAGGAGCGCGAGCCTCTTACGGGACACGGCGACTGGGTGCG
CGACGTGGCCTGGTCGCCGACGGTGCTGCACAAGTCGTACATTGCCTCGGCGTCGCAGGACAAGACGGTGCGCAT
CTGGGCGTCGGACGCGTCGGGTTCTGGACAGTGGGACTGCAAGGTGCTCAGCTTTGAGGCGGCCATGTGGCGGGT
GAGCTGGTCGCTGAGCGGCAACGTGCTGGCTGTCAGCGGAGCGGATAACAAGGTGTCGTTGTGGAAGGAGAACCT
GCGAGGCGAGTGGGAGTGTGTCAAGACGATTGAGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail